KEGG   Xenopus laevis (African clawed frog): 380245
Entry
380245            CDS       T01010                                 

Gene name
pdgfra.L, G37, pdgfr2, pdgfra, pdgfralpha
Definition
(RefSeq) platelet-derived growth factor receptor, alpha polypeptide L homeolog
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04020  Calcium signaling pathway
xla04144  Endocytosis
xla04510  Focal adhesion
xla04540  Gap junction
xla04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    380245 (pdgfra.L)
   04020 Calcium signaling pathway
    380245 (pdgfra.L)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    380245 (pdgfra.L)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    380245 (pdgfra.L)
   04540 Gap junction
    380245 (pdgfra.L)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    380245 (pdgfra.L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    380245 (pdgfra.L)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:xla04090]
    380245 (pdgfra.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     380245 (pdgfra.L)
Protein kinases [BR:xla01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   380245 (pdgfra.L)
CD molecules [BR:xla04090]
 Proteins
  380245 (pdgfra.L)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set Herpes_gE
Other DBs
NCBI-GeneID: 380245
NCBI-ProteinID: NP_001080553
Xenbase: XB-GENE-6072934
UniProt: Q7ZY71
LinkDB
Position
1L
AA seq 1087 aa
MMPAMRASLILGCLLIIGPWAILAENPLPTIFPDKDELVQALHSSFTLKCTGESEVSWQN
PNSNPEKQNVVIRSEENNSGLFVSILEVSDASAFDTGLYTCYHNHTQTEESEIEGTDIYI
YVPDPNVPFAPPGLFDHIIVVEEDESALVPCRTTDPSSEVMLKNIESSRTVFAFYDSKQG
FAGNFPPGSYICETTSNKMVYQTEPYILQTWKATHNISVEMEAPKTMFRAGETIAIDCIV
LDNEVVDLKWTYPGKQRGVGIRNVEESKVPYQRLVYTLTLANATTEDSGEYECAVIHATL
DNRVVKKTNITVHEKGFIDLEPMFGSEEFANLHEVKSFIVNLHAYPTPGLFWLKDNRTLS
ENLTEITTSIVTTKETRFQSKLKLIRAKEEDSGLYTLVAQNDAETKSYSFMLQIKVPALI
LELVDKHHGASGEQTVGCLAKGMPVPDVEWLVCKDIKRCNNDTLWSILATNGSEISMETH
QDDEQIESQVTFKKIEETMAIRCIAKNELGVVARELKLVAPTLRSELTVAAAVLVLLVIV
IISLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRI
LGSGAFGKVVEGAAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGAHLNIV
NLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFQSRHPEKPKKDLDIFGLNPADESTR
SYVILSFENNGDYMDMKQADTMQYVPMLEMKEPSKYSDIQRSLYDRPASYKKKPLSEVKN
ILSDDGFEGLTVLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAHGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSFGILLWEIFSLGGTPYPGMI
VDSTFYNKIKSGYRMTKPDHATHEVYDIMVKCWNSEPEKRPSFGHLSDIVESLLPTEYKR
CYETVLHDFLKSDHPAVTRMRSDSDNSYIGVTYKNEHKMKDRESGFDEQRLSADSGYIIP
LPDIDPVSDDESGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIEMMDDIGIDPSD
LVEDSFL
NT seq 3264 nt   +upstreamnt  +downstreamnt
atgatgcctgccatgagggcatctcttattttgggatgtctcctgattataggtccgtgg
gcaattcttgctgaaaatcctttgcccaccatatttcctgacaaggatgagttggttcag
gcgttgcactcctcctttacactaaaatgcactggcgaaagtgaggtgagctggcagaac
cccaattccaatcccgagaagcaaaatgtagtcattcgaagtgaagaaaacaacagcggc
ctctttgtgtccattctggaagtgagcgatgcgtctgcctttgatacgggactttacacc
tgctaccacaatcacacccagactgaggagagtgagattgaaggcacagatatctacatc
tatgtcccagatcctaatgttccttttgctccccctgggttatttgaccatattatcgtg
gttgaggaagatgagtctgctttggtaccttgtcgcactactgacccttcaagcgaagtg
atgctgaaaaatatagaaagttctagaactgtcttcgccttttatgacagtaagcaaggg
tttgccggaaatttccccccaggatcgtacatctgtgaaacaacctccaacaaaatggtc
tatcagacagaaccttacattttacagacatggaaagcaactcacaacatttcagttgag
atggaagcgcccaagactatgttcagagctggggaaaccattgctattgactgcattgtg
ctggacaatgaggtggtagacttgaagtggacctacccaggaaaacagagaggggttggc
attagaaatgtcgaagaaagcaaggttccgtatcagcgactggtgtacactttaaccctc
gcaaatgccactacagaagactcgggagagtacgagtgcgccgttatacatgcaaccctc
gataaccgggtagtcaagaagacaaacataacagttcatgaaaagggattcattgacctg
gagcccatgtttggatcggaggaatttgccaatctccacgaagtgaagagctttatagta
aacctgcatgcgtatcccacccctgggctcttctggctgaaggacaaccggacactgagt
gaaaatctgacagagatcaccactagcattgttacaactaaagaaaccaggtttcagagt
aaacttaaactgatccgggccaaagaagaagacagtgggctatatactctggtggcacaa
aatgatgcagaaactaaaagttactcatttatgttgcagataaaagtaccagctttgata
ttggaactggttgataagcatcatggggcatctggtgaacagactgttgggtgcttagcc
aaagggatgccggtccctgatgtggaatggctggtctgcaaggacattaaaagatgcaac
aatgacaccttgtggtccattctggcaacaaatggatcagaaatcagtatggagacccat
caagatgatgagcaaattgaaagccaggtgaccttcaagaaaattgaggagacaatggca
atccgatgtatcgcaaagaatgaacttggtgttgtggccagggaactaaagttggttgca
cctaccctgcgttcggagctaactgtggctgctgctgtcttggtccttctggtgattgtc
atcatatccctcattgtacttgtcatcatatggaaacagaaaccaaggtatgaaataaga
tggcgagtaatcgagtccatcagcccagatggccatgaatatatctatgtggatccaatg
cagcttccttatgactctcggtgggagttcccaagagatggacttgttcttggtcgcatc
cttggctctggagcttttgggaaagtggttgaaggcgccgcatatggattaagtcgttct
cagccagttatgaaagttgctgttaaaatgttgaaacctactgcccggtcaagtgaaaag
caggcactgatgtccgaactgaagattatgacgcaccttggcgcacatctcaatatagta
aatttactaggagcctgtaccaagtcgggtccaatttatatcattactgaatactgcttc
tacggtgacctcgtgaattacctgcataagaaccgggataattttcagagccgacatcca
gagaaaccaaagaaggacttggatatctttgggctgaacccagctgatgaaagcacaaga
agctacgttattttatcatttgaaaacaatggcgactacatggacatgaaacaggctgac
accatgcagtatgtacctatgctggaaatgaaagaaccctccaagtattcagatatccag
agatccttgtatgaccgtcctgcatcgtacaagaagaagcctttatcagaagtgaaaaat
atcttgtctgatgatggattcgagggtctgacagtactggatttgctcagtttcacatac
caagttgcaaggggcatggagttcttagcctctaaaaattgtgtacatcgggatttggca
gctcgaaatgtcctattagcacatgggaaaattgtgaaaatctgtgactttggcctagcg
agagacatcatgcatgactccaactacgtatccaaaggcagcactttccttcctgtgaag
tggatggcacctgaaagcatcttcgataacttgtacacaactctcagtgatgtgtggtca
tttgggatcctgctatgggaaatattctctcttggtggcacaccataccctggcatgatt
gtagactcaactttctataataagataaaaagtggctacagaatgacaaaacctgaccat
gccacccatgaagtgtatgacatcatggtaaaatgctggaacagcgaaccagagaaaagg
ccatcatttggccatctgagtgacattgttgaaagtctacttcccacggaatacaaaagg
tgctacgagacagttcttcacgacttccttaaaagtgaccaccctgcagttacccgcatg
agaagtgacagtgacaattcctacattggggtgacgtataagaatgaacacaaaatgaag
gacagagaaagcggatttgatgagcagaggctgagtgctgacagcggttacattattccc
cttcccgatattgaccccgtctcagatgatgagtctggcaagaggaacaggcacagttct
cagacatcagaagaaagtgcaatcgagactggttccagcagttccacttttataaagagg
gaggatgagaccattgaagacattgagatgatggacgacattgggattgatccctcggat
ctagtggaggacagtttcctgtga

DBGET integrated database retrieval system