KEGG   Xenopus laevis (African clawed frog): 380296Help
Entry
380296            CDS       T01010                                 

Gene name
acaa1.L, acaa1
Definition
(RefSeq) acetyl-CoA acyltransferase 1 L homeolog
  KO
K07513  acetyl-CoA acyltransferase 1 [EC:2.3.1.16]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00071  Fatty acid degradation
xla00280  Valine, leucine and isoleucine degradation
xla00592  alpha-Linolenic acid metabolism
xla01040  Biosynthesis of unsaturated fatty acids
xla01100  Metabolic pathways
xla01212  Fatty acid metabolism
xla03320  PPAR signaling pathway
xla04146  Peroxisome
Module
xla_M00087  beta-Oxidation
xla_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    380296 (acaa1.L)
   00592 alpha-Linolenic acid metabolism
    380296 (acaa1.L)
   01040 Biosynthesis of unsaturated fatty acids
    380296 (acaa1.L)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    380296 (acaa1.L)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    380296 (acaa1.L)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    380296 (acaa1.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     380296 (acaa1.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 380296
NCBI-ProteinID: NP_001080604
Xenbase: XB-GENE-963073
UniProt: Q7SYR2
LinkDB All DBs
Position
6L
AA seq 419 aa AA seqDB search
MHRVRVVLGHLPANSRGVWAENSSASADKSQDIVIVAGRRTPICKAKRGAFKETTPDELL
STVMTAVLKDVNVSPELLGDICVGNVLQPGAGALVARIGQFLSGIPESVPIHVVNRQCSS
GLQAIINVAGGIRNGSYDIGLACGMESMSLRSVGSPGDISSRTMDFSKARDCLIPMGITS
ENVAEKFGVTREKQDSLALASQQRAAAAQRSGRFKAEIVPVTTTFTDDQGNTKTITVTED
EGVRASTTMEGLSRLKPAFKEGGSTTAGNSSQVSDGAAAVLMAKRSRAEQLGLPILGVLR
SFAVVGVPPDVMGIGPAYAIPAALQKAGLTVHDIDVYEINEAFASQAVYCVEKLGIPVEK
VNPNGGAIALGHPLGCTGTRQTVTLLNELKRRGKRGFGVVSMCIGTGMGAAAVYEYPGH
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgcacagggttcgggtagtgctgggccacctgccggctaattctcgaggagtatgggca
gagaacagctcagcgtccgcggacaaatcccaggacattgttatagttgccggccggagg
acccccatctgcaaagcgaaaagaggcgcctttaaggagacgacccctgatgagctgctt
tccactgtaatgaccgctgtcctgaaggatgtgaatgtgagccctgagctgctgggagat
atctgtgtgggaaatgtattacagccgggagctggggcattggttgcaaggatcggtcag
tttttaagtggaattcctgagagtgttcctatacatgtagtgaatagacagtgctcctca
ggtctgcaggctatcatcaacgttgcaggtggcatcagaaatgggtcatatgacattggt
ttggcatgtgggatggagtcaatgagcctgagaagtgtagggagtcctggagatatcagc
tctcgcactatggacttcagtaaagccagagactgcctgatccctatggggattacctct
gaaaatgttgcagaaaaattcggagtcaccagagaaaaacaagattccttggccctggcc
tcccaacaaagggcggcagcggctcagagatcagggcgctttaaagcggaaatcgttcct
gtaaccaccacctttaccgacgatcagggcaataccaaaaccataacggtgacggaagat
gagggtgttcgggcaagtaccaccatggagggtctcagcaggctaaagccagccttcaag
gaagggggaagcaccaccgccggaaattccagtcaggtcagtgatggtgctgctgcagtg
ctgatggctaaacgctctagagctgagcagttggggctccccatattgggggtactgagg
tcatttgcagtggttggtgttcctcctgatgtcatggggattggaccagcctatgctata
cctgctgctttgcagaaagcaggtttaactgtgcatgacattgatgtatatgaaattaat
gaagcattcgccagccaggctgtgtattgtgtggagaaactggggatccctgtggagaaa
gtgaaccctaatggtggcgccattgcactgggacatccactgggctgtactgggacacgt
cagactgtcaccctactcaacgagctcaagagaagaggcaaaaggggatttggtgttgtg
tccatgtgtataggaacaggaatgggcgctgctgctgtgtatgaatacccagggcattag

DBGET integrated database retrieval system