KEGG   Xenopus laevis (African clawed frog): 380383
Entry
380383            CDS       T01010                                 

Gene name
ppm1d
Definition
(RefSeq) protein phosphatase 1D magnesium-dependent, delta isoform
  KO
K10147  protein phosphatase 1D [EC:3.1.3.16]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    380383 (ppm1d)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:xla01009]
    380383 (ppm1d)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     380383 (ppm1d)
Protein phosphatases and associated proteins [BR:xla01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    380383 (ppm1d)
SSDB
Motif
Pfam: PP2C PP2C_2 DUF5330
Other DBs
NCBI-GeneID: 380383
NCBI-ProteinID: NP_001080691
UniProt: Q7ZXI0
LinkDB
Position
2S
AA seq 554 aa
MEIPFTLRVSVSSDQGGRKYMEDVIQIVVGPEPGEDELPWSEEEEGTPAKNCRSENRQTV
AFFAVYDGHGGREAAHFARDHLWAHIRKQKGFLSRDPEEVCGAIRKGFVACHHAMWKKLP
EWPKTMTGLPSTSGTTATVVIIRGNKMYVAHVGDSGVVFGLQNGSRDSLKAVEATQDHKP
ELPRERERIEGLGGSVINKSGVNRVVWKRPRLTHNGPVRRSTVIDQIPFLAVARALGDLW
SYDFYSGEFVVSPEPDTSVHTIDPQKHKLIIIGSDGLWNMVSAQDAISMCQEQEKACATG
DHGQTCAKTLVSRALTQWRQRMLRADNTSVVVISISPLTEKPRSCVGEELFLNLAENPCY
NNQDMSHLSSTPCSTPIKFLDEDSWWKLTFSEPLPSLVYRSAFSSKCEKWSSETGKSRAD
ISSPTLGDVEKSESKGKLSQWPSDNPSTCLFPGSSPAASSDGKTATVQNSSQTRKTETER
LASLKRTLEESNSGPAVKKLKRNFPRNSMVPIESPSTTPKRRSADRVTMRRSLRGQKKLG
HPLLQQHRKTICAC
NT seq 1665 nt   +upstreamnt  +downstreamnt
atggagattccattcaccctgcgggtgagcgtgtcgtcggaccagggaggaaggaagtat
atggaggatgttatccagatagtagtgggaccggagccgggggaggacgagctgccttgg
tcggaggaagaggaagggacaccggctaaaaactgcaggagtgagaacaggcagactgtt
gccttcttcgctgtttatgatggacatgggggtcgggaagcagcccactttgctcgggac
catctttgggctcatatccgcaaacagaaaggcttcctgtcccgagatcccgaggaagtg
tgcggcgccatccgcaagggcttcgtggcttgtcaccatgcgatgtggaaaaagctccct
gaatggcctaagaccatgaccggtctcccgagtacatctggaaccacagccactgtagtt
attatcagaggcaataagatgtatgtggctcatgtgggagactcgggtgttgtgtttgga
ctgcagaatggctcaagagactctctgaaggctgtagaagcgacacaggaccacaagcct
gagcttccacgggaaagagagagaattgaaggccttggtggcagtgttataaacaaatct
ggagtaaacagagtggtgtggaaaaggcctcgtttgacacacaatggacctgtaagaaga
agcacagtcatcgatcaaattccattcttggctgtggctcgggcccttggtgacctgtgg
agttatgatttctacagtggcgagtttgtggtgtcacctgaaccagacacaagcgtgcac
actattgatccccagaagcacaagctcattattataggcagtgatggtctctggaatatg
gtgtctgcacaggatgctatatctatgtgtcaggagcaggagaaagcctgtgcaactgga
gatcatggacagacgtgcgcaaagacgcttgtgagtcgagctctgacccaatggcgacaa
cgcatgctgagagctgataataccagtgttgttgtgatctccatctctcccctgacagaa
aagccaaggagctgtgtgggtgaggagctgttcctaaacctggctgagaatccctgctat
aataaccaggacatgagtcacttgtcttccacaccatgctccactcctatcaagttccta
gatgaagattcttggtggaagctgaccttctctgaaccccttccatctctagtatacagg
agtgctttctcctccaagtgtgaaaaatggagcagtgagacaggaaaatctagggctgac
atttcttccccaacccttggggatgtggaaaagtctgaatcgaaaggcaaactttcccag
tggccgagtgacaatccttctacctgtcttttccctggcagttctccagctgctagctct
gatggcaaaacagcaacagttcaaaatagcagccagactaggaagacggaaacggaaagg
ttggcctccttgaaacggactctggaggaatcgaacagtggaccagcagtgaagaaactc
aagagaaacttccctaggaatagcatggtgccaatagagagcccatccaccacgccaaaa
cgcagaagtgcggacagagtgacaatgaggcgcagccttagagggcagaagaaacttgga
catcctttgttacagcagcaccgaaaaacaatatgtgcctgttaa

KEGG   Xenopus laevis (African clawed frog): 443988
Entry
443988            CDS       T01010                                 

Gene name
ppm1d.L, ppm1d
Definition
(RefSeq) protein phosphatase, Mg2+/Mn2+ dependent 1D L homeolog
  KO
K10147  protein phosphatase 1D [EC:3.1.3.16]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    443988 (ppm1d.L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:xla01009]
    443988 (ppm1d.L)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     443988 (ppm1d.L)
Protein phosphatases and associated proteins [BR:xla01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    443988 (ppm1d.L)
SSDB
Motif
Pfam: PP2C PP2C_2
Other DBs
NCBI-GeneID: 443988
NCBI-ProteinID: NP_001085562
Xenbase: XB-GENE-1011383
UniProt: Q6GQ14
LinkDB
Position
2L
AA seq 554 aa
METPFSLRVSVSSDQGGRKYMEDVTQILVEPEPGEDELPWSEGEEETPAKNCRRESGSRQ
TVAFFAVYDGHGGREAAHFARDRLWGHISKQKGFLSRDPEEVCGAIRKGFVACHHAMWKK
LPEWPKTMTGLPSTSGTTASVVIIRGNKMYVAHVGDSGVVFGLQNGTRDTLKAVEVTQDH
KPELPRERERIEGLGGSVINKCGVNRVVWKRPRLTHNGPVRRSTVIDQIPFLAVARALGD
LWSYDFYSGEFVVSPEPDTSVHTIDPQKHKFIIIGSDGLWNMVSAQDAISMCQEQERACV
TGDHGQTCAKMLVSRALTQWRQRMLRADNTSVVVISISPLTEKPRSCVGEELFLNLAENP
SYNSQDMCHLSSTPCSTPPIKFLDEDSWWKLSFSEPLPTLVRRNAFSSKWSSEAEKSKAD
IYSPTLEDVGLSESKGSLSQWPSDDPSSCLFPGSSSAASSVGKTAKVQNSSQTKKTESER
LASLKRTLEESNSAPAVKKLKRNFPRNSTGQTELPSTTPKRRSADRVTMRRSLRGQKKLG
HPLLQQHRKTICVC
NT seq 1665 nt   +upstreamnt  +downstreamnt
atggagactccattctccctgcgggtgagcgtgtcgtcggaccagggaggaaggaagtat
atggaggatgtcactcagatactagtggaaccagagccgggggaggacgagctgccttgg
tcggagggagaggaagagacaccggctaaaaactgcaggagggagagtgggagcaggcag
actgttgccttcttcgctgtttatgatgggcacgggggtcgggaagccgcccactttgct
cgggaccgtctttgggggcatatcagcaaacagaaaggcttcctgtcccgagatcccgag
gaagtgtgcggcgccatccgcaagggcttcgtggcttgtcaccatgcgatgtggaaaaag
ctccctgaatggcctaagaccatgaccggtctcccgagtacgtccggaaccacagccagt
gtagttattatcagaggcaataagatgtatgtggcccatgtgggagactcaggtgttgtg
tttggactgcagaatggcacaagagacactctgaaggctgtcgaagtgacccaggaccac
aagcctgagcttcctcgggagagagagcgaattgaaggccttggtggcagtgttataaac
aaatgtggagtaaacagagtggtgtggaaaaggcctcgtttgacacacaatggtcctgta
agaagaagcacagtgattgatcagattccattcttggctgtggctcgggctcttggtgac
ctgtggagttatgatttctatagtggcgagtttgtggtgtcaccggaaccagacaccagt
gtgcacactattgatccccagaagcacaagttcatcattataggcagtgatggtctctgg
aacatggtgtctgcacaggatgccatatctatgtgtcaggagcaggagagagcctgtgta
actggagatcatggacagacatgcgcaaagatgcttgtgagtcgagctctgacccaatgg
cgacaacgcatgctacgagctgataataccagtgttgttgtgatctccatctctcccctg
acagaaaagccaaggagctgtgtgggtgaggagctgttcctaaacctggctgagaatccc
tcctataatagtcaggacatgtgtcacttgtcttccacaccatgctccactcctcctatc
aagttcctagatgaagattcgtggtggaagctgagcttctctgaaccccttccaactctt
gtacgccggaatgctttctcctcaaaatggagcagtgaggcagaaaaatctaaggctgac
atttattcccctacccttgaggatgtgggattgtctgaatcaaaaggcagtctttctcag
tggcccagtgatgacccttctagctgtcttttccctggcagttcttcagctgctagctct
gttggcaaaactgcaaaggtccaaaatagcagccagaccaagaagaccgaatcggaaagg
ttggcctccttgaaacggacgctggaggaatcgaacagtgcaccagcagtgaagaaactt
aagagaaacttccctaggaatagcacggggcagactgagctcccatccaccacgccaaaa
cgcagaagtgcggacagagtgacaatgaggcgcagccttagagggcagaagaaacttgga
catcctttgttacagcagcacagaaaaacaatatgtgtctgttaa

DBGET integrated database retrieval system