KEGG   Xenopus laevis (African clawed frog): 380463Help
Entry
380463            CDS       T01010                                 

Gene name
sdha.S, sdha, sdha-b
Definition
(RefSeq) succinate dehydrogenase complex subunit A, flavoprotein (Fp) S homeolog
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00020  Citrate cycle (TCA cycle)
xla00190  Oxidative phosphorylation
xla01100  Metabolic pathways
xla01200  Carbon metabolism
Module
xla_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xla_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
xla_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    380463 (sdha.S)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    380463 (sdha.S)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     380463 (sdha.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 380463
NCBI-ProteinID: NP_001080770
Xenbase: XB-GENE-956949
UniProt: Q801S2
LinkDB All DBs
Position
6S
AA seq 665 aa AA seqDB search
MALLKVAPSRLLSRALQLTSTLQNCTATSIAARRNFHFTVYGRKDTSAKVSDSISTQYPV
VDHDFDAVVVGAGGAGLRAAFGLSEAGFNTACITKLFPTRSHTVAAQGGINAALGNMEDD
DWRWHFYDTVKGSDWLGDQDAIHYMTEQAPASVIELENYGMPFSRTEQGKIYQRAFGGQS
LKYGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIAL
CMEDGSIHRFRAKNTVIATGGYGRTYFSCTSAHTCTGDGTAMVTRAGLPCQDLEFVQFHP
TGIYGAGCLITEGCRGEGGILINSEGERFMERYAPVAKDLASRDVVSRSMTIEMREGRGC
GKDKDHVYLQLHHLPPSQLASRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNY
KGQVITHVNGEDRVVPGLYACGEAASASVHGANRLGANSLLDLVVFGRACALSIAEECKP
GEALPSIKENAGEESVANLDKLRFANGSTRTSELRLNMQKTMQTHAAVFRTGSVLKEGCE
KLSVINSAMDDLKTFDRGIVWNTDVVETLELQNLMLCALQTINSAEARKESRGAHAREDY
KTRIDEYDYSKPIQGQQKKSFSEHWRKHTLSYVDSKGKVSLEYRPVIDATLNEDCASVPP
AIRSY
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggctttgctgaaagtggcaccgtcaaggcttcttagcagagcactgcagttaaccagt
acactacagaactgcacagcaacttctatagcagcaaggcgtaactttcacttcacagta
tatggaaggaaggacacttcagcaaaagtttctgattcgatttcaacacagtatcctgta
gttgatcatgattttgatgcagttgttgttggtgctggtggtgctggattacgggctgcg
tttggattgtctgaagctggctttaatacagcttgcattacgaagctgtttcctacaaga
tctcacactgttgccgcacagggtggaattaatgctgccctgggtaatatggaagatgat
gactggaggtggcacttctatgacacagttaagggatcagactggcttggtgatcaagat
gccatccattatatgaccgaacaagcaccagcctctgttatcgagctggaaaattacgga
atgcctttcagcagaactgaacaggggaaaatttaccagcgtgcatttggaggacagagt
cttaaatatggaaaaggaggacaggctcaccgttgttgttgtgtggcagacagaacaggg
cattccttgctgcacacactctatggaaggtctcttaggtatgacaccagttattttgtg
gaatactttgccctggatcttttgatggaaaatggtgaatgtcgtggtgtgatcgccctc
tgtatggaagatggatccatacatcgcttcagggccaagaacactgttatagccactggg
ggatatggacgtacatatttcagctgtacctctgctcatacctgcactggagatggtact
gcaatggttactagagctgggcttccatgccaggatttagaatttgtacagtttcaccct
acaggaatctatggggcgggatgtttaataacagaaggttgccgtggggaaggaggaatc
cttatcaacagtgaaggtgaaaggttcatggaaagatatgcccctgtagcaaaggacttg
gcttcacgagatgtggtttcccgttctatgactatagaaatgcgagaaggaagaggctgt
gggaaggacaaagaccatgtttatcttcagcttcaccaccttccacccagtcagctggca
tcccgactcccaggaatttctgagacagcaatgatatttgcaggtgttgatgtaacaaag
gaacccattcctgtcctgccaacagttcattataacatggggggtatccccaccaattac
aaagggcaggtgattacccatgtaaatggtgaagatagagtggtgccagggctttatgct
tgtggagaggctgcatctgcttcagtacatggagccaacagattgggcgcaaactctctt
ctggatctggtggtctttggtcgtgcatgtgctcttagcattgcagaggagtgcaagcct
ggtgaagcgttgccatcaattaaggaaaatgcaggagaggaatccgttgcaaatctggac
aaattacgctttgctaatggaagcactagaacttcagaacttagactcaacatgcagaag
accatgcagactcatgctgcagttttccgaacaggttctgtgttgaaggaaggttgtgaa
aaactgagtgtcatcaattctgcaatggatgacttaaagacatttgatagaggtattgtt
tggaacactgatgtagtggagacactagagctacaaaacttaatgctatgtgcactgcaa
acaattaatagtgctgaggcacgcaaagaaagtcgtggtgcccatgcaagagaagattac
aagacgaggattgatgagtatgattattcaaaaccaattcaaggtcaacagaagaaaagt
tttagcgagcactggaggaagcacacactatcatatgttgatagtaaaggaaaggttagc
ttggaatacagacctgtaatcgatgcaactttaaatgaagactgtgcatctgtcccgccg
gcaattcgttcctactaa

DBGET integrated database retrieval system