KEGG   Xenopus laevis (African clawed frog): 394276
Entry
394276            CDS       T01010                                 

Gene name
rps6kb1.S, p70-alpha, p70-s6k, p70s6k, ps6k, rps6kb1, rps6kb1-A, s6K1, s6k, stk14a
Definition
(RefSeq) ribosomal protein S6 kinase, 70kDa, polypeptide 1 S homeolog
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04012  ErbB signaling pathway
xla04140  Autophagy - animal
xla04150  mTOR signaling pathway
xla04350  TGF-beta signaling pathway
xla04371  Apelin signaling pathway
xla04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    394276 (rps6kb1.S)
   04350 TGF-beta signaling pathway
    394276 (rps6kb1.S)
   04371 Apelin signaling pathway
    394276 (rps6kb1.S)
   04150 mTOR signaling pathway
    394276 (rps6kb1.S)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    394276 (rps6kb1.S)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    394276 (rps6kb1.S)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    394276 (rps6kb1.S)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     394276 (rps6kb1.S)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   394276 (rps6kb1.S)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 394276
NCBI-ProteinID: NP_001080935
Xenbase: XB-GENE-864871
UniProt: Q9W6Y9
LinkDB
Position
2S
AA seq 501 aa
MAGVFDIDLDQPEDAISDDELEDGGTFIEFMDHGSISYELGMEHCEKFEISEISVNKGPE
KIRPECFELLRVLGKGGYGKVFQVRKVIGAHTGKIFAMKVLKKAMIVRNAKDTAHTKAER
NILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISM
ALGHLHQKGIIYRDLKPENIMLNLQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEI
LMRSGHNRAVDWWSLGALMYDMLTGAPPFSGENRKKTIDKILKCKLNLPPYLTQEARDLL
KKLLKRNAASRLGAGVGDAGDVQGHSFFRHINWDDLLARKVEPPFKPLLQSEEDVSQFDS
KFTRQTPVDSPDDATLSESANQVFVGFTYVAPSVLESVKEKFSFEPKIRSPRRFISSPRT
PVSPVKFSAGDIWARGTAAGTSNTQTPGEFRMEAGGVEQMDVTVSGEASAPLPIRQSNAG
PYKKQAYPIISKRPEHLRMNL
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggctggggtgtttgacattgacctggaccagccggaggacgcgatatcagacgatgaa
ctggaggacgggggtacctttattgagttcatggaccatgggagtatatcttatgaacta
ggcatggagcattgtgaaaagtttgagatctcagagataagtgtgaacaaaggtccagag
aagatacgaccagaatgttttgagcttcttcgtgtactggggaaaggtggttatgggaag
gtttttcaggtacggaaagtaattggagctcatacaggaaaaatctttgcaatgaaagtg
cttaaaaaggctatgattgtacgaaatgctaaagacacagctcacactaaagctgagagg
aatattttagaagaagtaaagcatcctttcattgtggatcttatttatgcctttcaaact
ggtggaaaactctacctcatcctagagtatcttagcggaggagaactcttcatgcagctg
gaaagagaagggatatttatggaggacacagcctgtttttatttggcagagatctcaatg
gctttaggacatttacatcagaaaggaatcatttatcgagatttgaaaccagagaacatc
atgcttaatcttcaagggcatgtgaaacttactgattttggcctttgtaaagaatctatc
catgatggcacagtcacacacaccttctgtggaacaatcgaatacatggcaccggaaatc
ttaatgagaagcggtcataaccgtgctgtagactggtggagcctgggagctttgatgtat
gacatgcttactggagcaccgccgttctctggtgaaaacagaaagaaaactattgataaa
attctcaaatgtaaattaaacctgcctccctacctcactcaagaagccagagatctgctt
aagaagctgctaaaaagaaatgctgcatctcgtcttggagcaggagttggagatgctgga
gatgtgcagggtcactcctttttcagacacattaattgggatgatcttctggctcgtaag
gtggaacctccatttaaacctcttttgcaatctgaagaggatgtcagccaatttgattca
aagtttacacgacagacccctgtggacagtccagatgatgccactctcagcgaaagtgcc
aaccaggtgtttgtgggttttacctatgtggctccctctgtacttgaaagtgtgaaagaa
aagttttcatttgaaccaaaaattcgctctccgcgcagattcattagtagtcctcgaaca
cccgtaagccctgtgaagttttctgctggagatatctgggcaagagggacagctgctgga
acctcaaacactcagacaccaggggagtttcgaatggaagcaggcggtgtggaacaaatg
gatgtgactgtaagcggagaagcttcagcaccgctaccaatcagacaatctaatgctggg
ccatataaaaagcaagcttaccccataatttctaagcgacctgaacatctacgcatgaat
ctatga

KEGG   Xenopus laevis (African clawed frog): 394347
Entry
394347            CDS       T01010                                 

Gene name
rps6kb1.L, p70-alpha, p70-s6k, p70s6k, p70s6k-A, ps6k, rps6kb1-A, s6K1, s6k, stk14a
Definition
(RefSeq) ribosomal protein S6 kinase, 70kDa, polypeptide 1 L homeolog
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04012  ErbB signaling pathway
xla04140  Autophagy - animal
xla04150  mTOR signaling pathway
xla04350  TGF-beta signaling pathway
xla04371  Apelin signaling pathway
xla04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    394347 (rps6kb1.L)
   04350 TGF-beta signaling pathway
    394347 (rps6kb1.L)
   04371 Apelin signaling pathway
    394347 (rps6kb1.L)
   04150 mTOR signaling pathway
    394347 (rps6kb1.L)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    394347 (rps6kb1.L)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    394347 (rps6kb1.L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    394347 (rps6kb1.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     394347 (rps6kb1.L)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   394347 (rps6kb1.L)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 394347
NCBI-ProteinID: XP_018102314
Xenbase: XB-GENE-17345632
UniProt: A0A1L8HFU6
LinkDB
Position
2L
AA seq 521 aa
MRRGNVVPSRGAGKQKTSEAMAGVFDIDLDQPEDAISDDELEDGGTLTEFMDHGSISYEL
GMEHCEKFEISETIVNKGPEKIRPECFELLRVLGKGGYGKVFQVRKVIGDHTGNIFAMKV
LKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQL
EREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESI
HDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDK
ILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGVGDAGDVQGHPFFRHINWDDLLART
VEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDATLSESANQVFVGFTYVAPSVLESVKE
KFSFEPKIRSPRRFIGSPRTPISPVKFSPGDIWGRGAAAGTSNTQTPGEFRMEAGGVEQM
DVTVSGEASAPLPIRQSNAGPYKKQAYPMISKRPEHLRMNL
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgaggcggggaaacgttgtaccaagccggggtgcggggaagcagaagacgtccgaggca
atggctggggtgtttgacattgacctggaccagccagaggacgcgatatcagacgatgaa
ctggaggacgggggaactttgactgagttcatggaccacgggagtatatcttatgaactt
ggcatggaacattgtgagaagtttgagatctcagagacaattgtgaacaaaggtccagaa
aagatccgaccagaatgtttcgagctacttcgtgtactggggaaaggtggttatgggaag
gtttttcaggtgcgtaaagtaattggagatcatacaggaaatatctttgcaatgaaagtt
cttaaaaaggccatgattgtacgaaatgctaaagacacggctcacactaaagcagagcgg
aatatactagaagaagtaaagcatccgttcattgtggaccttatttatgcctttcagact
ggtggaaaactctacctcatcctggagtatcttagcggaggagaactcttcatgcagctg
gaaagagaagggatatttatggaggacacagcctgtttttatttggcagagatctcaatg
gctttaggacatttacatcagaaaggaatcatttaccgagatttgaaaccagagaacatc
atgcttaatcatcaagggcatgtaaaactaactgattttggcctttgtaaagaatctatc
catgatggcacagtcacacacaccttctgtggaacaatagaatacatggcacctgaaatc
ttaatgagaagtggtcataaccgtgctgtagactggtggagcctgggggctttgatgtat
gacatgctaactggagcaccgccattcactggtgaaaacagaaagaaaacaattgataaa
attcttaaatgtaaattaaacctgcctccctacctcactcaagaagccagggatctgctt
aagaagctgctaaaaagaaatgctgcatctcgccttggagcaggagtgggagatgctgga
gatgtgcagggtcacccctttttcagacacattaattgggatgatcttctggctcgtacg
gtggaacctccctttaaaccgcttttgcaatctgaagaggatgtcagccaatttgattca
aagtttacacggcagacccctgtggacagtccagatgatgccactctcagcgaaagtgcc
aaccaggtgtttgtgggttttacctatgtggctccctctgtacttgaaagtgtgaaagag
aagttttcatttgaaccaaaaattcgctctccacgcagattcattggtagtcccagaaca
cccataagccctgtgaagttttctcctggggatatctggggaagaggagcagctgctgga
acctcaaatactcagacaccaggggagtttcgaatggaagcaggtggtgtggaacaaatg
gatgtgactgtaagcggagaagcttcagcaccgctaccaatcagacaatctaatgctggg
ccatataaaaagcaagcttaccccatgatttctaagcgaccagagcatctacgcatgaat
ctatga

DBGET integrated database retrieval system