KEGG   Xenopus laevis (African clawed frog): 394389Help
Entry
394389            CDS       T01010                                 

Gene name
lig4.L, lig4, lig4-A
Definition
(RefSeq) ligase IV, DNA, ATP-dependent L homeolog
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:xla00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    394389 (lig4.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:xla03400]
    394389 (lig4.L)
Enzymes [BR:xla01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     394389 (lig4.L)
DNA repair and recombination proteins [BR:xla03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     394389 (lig4.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_IV BRCT BRCT_2 RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 394389
NCBI-ProteinID: NP_001081114
Xenbase: XB-GENE-964449
UniProt: Q6GLS1
LinkDB All DBs
Position
2L
AA seq 911 aa AA seqDB search
MSTPKASDSAAEHTVASQVPFADLCCTLEKIQKCKNRTEKSHIFKQFVDSWRKFHDALHK
NRPKTTDSFYPAMRLVLPQLERERMAYGIKETMLAKLYIKVLGLPKEGKDALKLLNYRTP
TSSHSDAGDFAAIAYFVLKSRCRKEGNLSIQEVNYHLDSIANNNAAKKKELIEKSLLHLI
ANTTALEQKWLIRMIIKDMKLGFSQQTIFSIFHPDAVELHNVTTDLEKVCIQLHDPDVCL
SDVSISMFSAFKPMLAAVANIQNIEKQMNHQSFFIETKLDGERMQMHKDGDVYKYFSRNG
FDYTQQFGASPLEGSLTPYVHNAFRLDTQNCILDGEMMAYNPNTQTFMQKGNKFDIKHMV
EDSELQTCYCVFDILLLNDEKLAHETLRKRYDILKEIFIPIPGRFHIVDKTEASTKKNVV
DALNEAIDKREEGIMVKDPMSIYKPDKRGEGWLKIKPEYVNGLMDELDLLIIGGYWGKGS
RGGMMSHFLCGVAEASGPGEKPSVFHSICRVGSGYTMKELFDLGLKLAPHWKTYRKRDPP
SNILCGIEKPEVFIQPCNSVILQIKAAEIVSSDMYKTGCTLRFPRIEKIREDKEWYECMT
LDDLEQFRDKASGKLASKHLDVDDEPHEKKRKTAPKLKKVIGIVSHLKAPDLSNVHQESS
MFTEVEFCVMSGTDQHSKADLENIIAKCGGIVVQNPGADTYCVIAGIENVRVKNVICSNK
HDVVRAAWLLECFENKTVVPWQPHHMIHMCPSTAEHFACEYDCYGDSYVTDTSEYPLRDV
FHRMSKIKEKIPFEMMANLEERYSWNNSSYNIFRHCTVYVDSFATINDPTTRINTSSLNI
RALELRFHGAKLVNQLDEGISHVLVSEDLSRLEQIKTMRRAMAKKFKIVSVSWVLDSVKM
RVPQMENAYLL
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgccgaaagcctcagattctgcagccgaacatactgtggcctcacaagtgcct
tttgctgatctctgttgtactcttgaaaaaattcaaaaatgcaaaaacagaactgagaaa
agtcatatttttaaacagtttgttgattcctggagaaaatttcatgatgccctccataaa
aatcggccaaaaacaaccgattctttctatccagccatgcgtcttgttcttccacaactt
gaaagagagagaatggcttatggaatcaaagaaaccatgcttgcgaaattgtacattaaa
gttttaggcttacctaaagaaggcaaagatgcattaaagcttttgaattatagaacgcca
actagttcacatagtgatgcaggggattttgctgccattgcttattttgttctcaagtca
cgatgcagaaaagaggggaacttgtcgatacaagaagtaaattaccatttagattcaatt
gctaataataatgcagcaaaaaagaaggaactcatagaaaaaagtttactgcatttaatt
gctaacacaactgctcttgaacaaaagtggcttatcagaatgattattaaggacatgaaa
cttggttttagccagcaaactattttctccatcttccaccctgatgcagtagaactgcat
aatgttaccactgatcttgagaaagtttgtattcagctccatgatcctgatgtctgtctc
agtgatgtttctatatcaatgttctctgcttttaaaccaatgctggctgcggtcgccaac
attcagaatattgaaaaacaaatgaaccaccaaagttttttcattgaaacgaaactggac
ggagaacggatgcagatgcacaaagatggggatgtgtataaatatttctcacggaatgga
tttgattacacacagcagttcggtgcatctcctcttgaaggctctttgaccccatatgtt
cacaatgcttttagactggacacccaaaattgcattctagatggagaaatgatggcctac
aatccaaatactcagactttcatgcaaaaaggaaacaagtttgatattaaacacatggta
gaagattctgaattgcaaacttgctactgtgtttttgacatactgctgcttaatgatgaa
aaattagcacatgaaacactcagaaaaagatatgacattctgaaagagatttttatccca
ataccaggcagattccatattgttgataaaactgaagcaagcacaaaaaagaatgttgtg
gatgcacttaatgaagcaattgataaaagggaagaaggcattatggttaaagatccaatg
tctatctacaaaccagacaaacgtggggaaggatggctgaagattaaacctgaatatgtt
aatggtttaatggatgagctagacttattaatcattggaggctactggggaaaaggttcc
cgtggtggaatgatgtcccatttcttatgtggtgttgctgaagcttcaggtcctggggaa
aaaccatctgtttttcactcaatttgtcgtgttggctctggttacaccatgaaagaatta
tttgatcttggtttaaagttggctcctcactggaaaacatatcggaagagagaccctccc
agcaatattctttgtggaatagagaaacctgaagtgtttattcaaccttgtaattctgtc
attctgcaaattaaagcagcagaaattgtttccagtgatatgtacaaaacgggttgcact
ctgagattccctcgcattgaaaaaataagggaagataaggaatggtatgagtgcatgaca
cttgatgacctggaacagtttagagacaaagcatcggggaaactggcttcaaaacactta
gatgttgatgatgaaccacatgaaaagaaaagaaaaactgcacccaagcttaagaaagtt
attggaattgtttcacacctaaaagcacctgaccttagtaatgtacatcaggagtcttct
atgtttacagaggtggagttctgtgttatgagtggaacagaccaacattctaaagctgat
ctagagaacattattgctaaatgtggtggtattgtggtacagaatcctggagcagataca
tattgcgttattgcaggaatcgagaatgtgagagtgaaaaacgttatctgctcaaataag
catgatgttgttagagcagcttggctattggaatgttttgaaaataaaactgttgtgccc
tggcagcctcaccacatgatacacatgtgcccatcgactgcagaacattttgcttgtgaa
tacgactgctatggtgatagctatgtcacagatacaagtgaatatccattaagagacgtt
tttcacagaatgtctaaaataaaggaaaaaatcccctttgaaatgatggctaatttagaa
gagagatactcatggaataacagttcttataatatctttcgtcattgcacagtatacgtt
gatagttttgccaccattaatgacccaaccacaagaatcaatacatccagcctaaatata
agagcactggagctacggtttcatggtgccaagttagtaaaccagcttgatgaaggaatt
tcgcatgttctcgttagtgaagatttgtcccgtctagagcaaattaaaactatgaggagg
gccatggcaaaaaaattcaaaattgtctctgtttcatgggtacttgattcagtaaaaatg
agagtgcctcagatggaaaatgcctatttgctataa

DBGET integrated database retrieval system