KEGG   Xenopus laevis (African clawed frog): 397831Help
Entry
397831            CDS       T01010                                 

Gene name
rh50
Definition
(RefSeq) 50 kD glycoprotein
  KO
K06580  ammonium transporter Rh
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Transporters [BR:xla02000]
 Solute carrier family (SLC)
  SLC42: Rh ammonium transporter
   397831 (rh50)
CD molecules [BR:xla04090]
 Proteins
  397831 (rh50)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ammonium_transp AzlD
Motif
Other DBs
NCBI-GeneID: 397831
NCBI-ProteinID: NP_001081429
Xenbase: XB-GENE-983545
UniProt: Q9DGD8
LinkDB All DBs
Position
5L
AA seq 424 aa AA seqDB search
MRFRLPALALALEIIIIILFGIFVKYDTSEHNDPQHNSTAGYSQFLSLYPLFQDVHVMIF
VGFGFLMTFLKRYGFSSVGVNMLIAALGLQWGILMQGFWHLHHGKIQVDILKMINADFST
ATVLISFGAVLGKTSPVQMLIMAIIEIAIFAGNEHLAGMLGASDIGASMTIHTFGAYFGL
AAAVVLYRPSLKNGHENEGSVYHSDLFAMIGTLFLWMFWPSFNSAIADPGMNQQMAIINT
YFSLAASVLTAYAISSFVEHKGKLDMVHIQNATLAGGVAVGTCADMNIGPFGAMIIGFTA
GIISTLGFKFLTPFLATKLRIQDTCGVHNLHGLPGILGGLAGIVSAAVGAKEGCTPAMQA
ASLAATLGISIVGGALTGFILKLPFLGQPPDQNCYDDSIYWEVPLEEPEQENQHQNEHGK
ILEA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaggttccgactccccgctttagcccttgcgctggaaataataattattattttattt
ggaatattcgtcaaatacgacaccagcgagcacaatgatcctcaacacaattccacggct
ggttacagccaattcctcagcctgtatcctttattccaggatgtccatgtcatgatcttc
gttgggttcggtttcctgatgacatttctaaagagatatgggttcagcagtgtcggggtc
aatatgctcattgctgcactgggacttcagtggggaatattaatgcaaggattctggcac
cttcatcatgggaaaattcaagtcgatatattaaaaatgatcaatgctgatttcagtacc
gcgactgtcctgatctcattcggtgctgtcctggggaagacaagtccagtccaaatgcta
atcatggcaattatagaaattgctatatttgctggcaatgagcatctggctggaatgctg
ggggcgagtgacatcggcgcttccatgaccattcatacctttggagcttactttggcctg
gcggctgcagtggttttataccgtccttcgctgaaaaatggccatgaaaacgaagggtct
gtttatcactcggatttgtttgctatgatcggaacccttttcctctggatgttttggcca
agcttcaattctgccattgccgatcctggcatgaaccaacaaatggccattattaacact
tacttttccttggctgccagcgtgctcactgcctatgctatttccagctttgttgaacac
aaaggcaaattggatatggttcatatccaaaatgccaccttagctgggggagtggcagtc
ggtacatgcgctgatatgaacatcgggccttttggagccatgatcattggattcacagct
ggaatcatttcaacccttggcttcaaattcctgactccattcttggcaacaaagttgcgt
atacaagatacatgtggcgtgcacaacttgcatggtttgcccggcatcttgggaggactt
gcagggatagtgtctgcagcagtcggagctaaagaaggctgcaccccagctatgcaagct
gcttcattggctgcaacactgggaatctctattgttggaggagctctcacaggatttatc
cttaagttgcctttcttgggccagccacctgaccaaaattgctatgatgattccatttat
tgggaggtccccctagaagaacctgaacaggaaaaccaacaccagaatgaacatgggaaa
attttagaagcataa

DBGET integrated database retrieval system