KEGG   Xenopus laevis (African clawed frog): 397853Help
Entry
397853            CDS       T01010                                 

Gene name
prss1.L, Trypsin, prss1, trp1, try1
Definition
(RefSeq) protease, serine 1 L homeolog
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    397853 (prss1.L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:xla01002]
    397853 (prss1.L)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xla04147]
    397853 (prss1.L)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     397853 (prss1.L)
Peptidases [BR:xla01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   397853 (prss1.L)
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   397853 (prss1.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 397853
NCBI-ProteinID: XP_018080424
Xenbase: XB-GENE-5776767
UniProt: P70059 A0A1L8FHX9
LinkDB All DBs
Position
7L
AA seq 244 aa AA seqDB search
MKFLVILVLLGAAVAFEDDDKIVGGFTCAKNAVPYQVSLNAGYHFCGGSLINSQWVVSAA
HCYKSRIQVRLGEHNIALNEGTEQFIDSQKVIKHPNYNSRNLDNDIMLIKLSTTARLSAN
IQSVPLPSACASAGTNCLISGWGNTLSSGTNYPDLLQCLNAPILTDSQCSNSYPGEITKN
MFCAGFLAGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQRNYPGVYTKVCNFVTWIQST
ISSN
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcctcgtcatcttggtcttgctgggagcagccgttgcttttgaagatgatgat
aagattgtagggggttttacgtgcgccaagaacgctgttccctatcaagtgtccctaaac
gctggttaccatttctgtggggggtccttgattaacagtcagtgggtggtgtctgccgct
cattgctacaaatctcgtatccaggtcagacttggggagcacaacatcgctttaaatgaa
gggacagaacaattcattgattcacagaaagtcatcaagcaccccaactacaactccagg
aacctggacaatgacatcatgttgatcaaactttccaccactgccagacttagcgccaac
atccaatccgtgcctctgccctcggcctgtgcttctgccggcaccaactgcctgatctct
ggctgggggaacaccctgagcagcggcaccaattacccagatctcctgcagtgcctgaat
gccccaatcctgactgacagtcagtgcagtaacagctaccccggggagatcaccaagaac
atgttctgtgccggctttttggctggtggcaaagactcttgccagggtgattctggtggc
cccgtggtgtgcaatgggcagctgcagggtgtggtatcctggggttatggctgtgcccag
aggaactatcctggtgtctatactaaagtctgcaactttgtgacttggatccagagcacc
atttcctctaactaa

DBGET integrated database retrieval system