KEGG   Xenopus laevis (African clawed frog): 397897
Entry
397897            CDS       T01010                                 

Gene name
nr3c1.S, gccr, gcr, grl, nr3c1, nr3c1-a, nr3c1-b, xGR
Definition
(RefSeq) nuclear receptor subfamily 3 group C member 1 S homeolog
  KO
K05771  glucocorticoid receptor
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    397897 (nr3c1.S)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xla03000]
    397897 (nr3c1.S)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:xla03310]
    397897 (nr3c1.S)
Transcription factors [BR:xla03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    397897 (nr3c1.S)
Nuclear receptors [BR:xla03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   397897 (nr3c1.S)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 397897
NCBI-ProteinID: NP_001081531
Xenbase: XB-GENE-865499
UniProt: Q6DDL0
LinkDB
Position
3L
AA seq 776 aa
MDPKDLLKPSSGSPAVRGSPHYNDKPGNVIEFFGNYRGGVSVSVSASCPTSTASQSNTRQ
QQHFQKQLTATGDSTNGLNNNVPQPDLSKAVSLSMGLYMGESDTKVMSSDIAFPSQEQIG
ISTGETDFSLLEESIANLQAKSLAPDKLIEISEDPGGFKCDISAQPRPSMGQGGSNGSSS
TNLFPKDQCTFDLLRDLGISPDSPLDGKSNPWLDPLFDEQEAFNLLSPLGTGDPFFMKSE
VLSEGSKPLSLEDGTQRLGDHAKDMLLPSADLPISQVKTEKEDYIELCTPGVVKQEKFGP
VYCVGNFSGSGLFGNKSSAISVHGVSTSGGQMYHYDLNTATISQQDVKPVFNLGSPGTSI
AEGWNRCHGSGNDTAASPGNVNFPNRSVFSNGYSSPGIRSDASPSPSTSSTSTGPPPKLC
LVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKC
LQAGMNLEARKTKKKIKGIQQSTTATARESPETSMTRTLVPASVAQLTPTLISLLEVIEP
EVLYSGYDSSIPDTTRRLMSSLNMLGGRQVVSAVRWAKAIPGFRNLHLDDQMTLLQYSWM
FLMVFALGWRSYKQTNGSILYFAPDLVITEDRMHLPFMQERCQEMLKIAGEMSSLQISYD
EYLCMKVLLLMCTIPKEGLKSHALFEEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKL
LDSMHEVAENLLAFCFLSFLDKSMSIEFPDMLSEIISNQIPKYSSGNLKKLLFHQK
NT seq 2331 nt   +upstreamnt  +downstreamnt
atggaccccaaagaccttttaaagccctccagtggatcaccggcagtgaggggctcacct
cattacaatgacaagccggggaatgtgattgaattctttggaaattataggggaggagtt
agtgtgagcgtctctgcatcttgcccaacctcaactgcttcacagtcaaacactaggcag
cagcagcattttcaaaaacagctgactgcgactggggactcaactaatggattgaataat
aatgtgcctcagccagatttatctaaagcagtctcgctctcaatgggactctacatgggg
gagtcagacacaaaagtgatgagcagtgatatcgcctttccatcccaagagcaaattggt
atctccacaggagaaactgattttagtctcttggaggagagcattgccaacttgcaggct
aagtcattggccccagataaactcatagagatctcagaggatcctgggggttttaaatgt
gacatatctgcccaaccaaggccttccatgggtcaagggggcagcaatgggagcagctct
accaatctgttccccaaagaccaatgcacctttgacctactacgggacctgggtatctcc
ccagactcacccctggacggtaaatcaaatccttggctagacccactttttgacgagcag
gaagcatttaacctgttgtccccactgggcaccggtgatccttttttcatgaaatctgaa
gtactgagcgagggtagcaaacctctcagcctcgaggatggcacacagagactcggtgat
catgccaaggacatgctgttgcccagtgcagacctgccaatttctcaagtcaagacagaa
aaggaggactacattgagctatgtacacctggcgtggtgaagcaggaaaaatttggtcct
gtgtattgtgtaggcaatttttctggatctggcttatttggtaacaaatcttcagctatt
tctgtccatggcgtcagcacttcaggtgggcagatgtaccactatgacttgaacactgcc
accatctcgcaacaggatgttaagccagtctttaatcttggctcacctgggactagcatt
gcagaaggctggaataggtgccatggatctgggaacgacactgccgcttctccagggaat
gtcaattttccaaacagatctgttttttcaaatggctattcaagccccggaataagatct
gatgcaagtccttctccatccacctcttctaccagcacggggcctccacccaagctctgt
ttggtgtgctctgacgaggcttctgggtgccactatggagtactgacttgtggcagctgt
aaagttttctttaagagagcagttgaaggtcagcataactatctttgcgctggacggaat
gactgcattattgataaaataagaaggaagaactgccctgcttgtcgctaccggaaatgt
cttcaagctggaatgaatctagaagctcggaagacaaagaagaaaatcaaaggaattcag
caatctactacagctacagcacgggagtctcctgaaacttctatgacgaggaccttggta
cctgcttctgtggcacaactcacacctaccctgatctcattactggaggttattgagcca
gaagtgttatattctggatacgacagctccataccagacacaaccaggaggcttatgtcg
tctctcaacatgcttggtgggcgccaagtggtgtctgctgtcagatgggcaaaggcaatt
ccaggtttcagaaacttgcacctggatgaccaaatgacccttcttcagtactcatggatg
tttttgatggtgtttgcacttggatggcgatcttacaaacaaaccaatggaagtattctg
tattttgcgccagatctcgtcattactgaggacaggatgcacctaccctttatgcaagag
agatgtcaggagatgttgaagattgcaggtgaaatgtccagtcttcaaatttcatatgat
gaatatctctgcatgaaagtcttgttgctcatgtgcacaattccaaaggaaggcctgaag
agccacgctctgtttgaggaaattcgtatgacatacattaaagagctgggaaaagccata
gtaaagcgggaaggaaattccagtcaaaactggcagcgcttttaccaactgacaaagcta
ttggactctatgcatgaggtggctgagaatctactggccttttgcttcctttccttcctg
gataaatcaatgagcatcgaatttccggatatgttgtcagaaatcatcagcaatcagata
ccaaaatattcatctggaaacctcaaaaaactgttatttcatcaaaagtga

DBGET integrated database retrieval system