KEGG   Xenopus laevis (African clawed frog): 397978Help
Entry
397978            CDS       T01010                                 

Gene name
lig1.L, lig1, lig1.S, ligI
Definition
(RefSeq) ligase I, DNA, ATP-dependent L homeolog
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla03030  DNA replication
xla03410  Base excision repair
xla03420  Nucleotide excision repair
xla03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:xla00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    397978 (lig1.L)
   03410 Base excision repair
    397978 (lig1.L)
   03420 Nucleotide excision repair
    397978 (lig1.L)
   03430 Mismatch repair
    397978 (lig1.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:xla03032]
    397978 (lig1.L)
   03400 DNA repair and recombination proteins [BR:xla03400]
    397978 (lig1.L)
Enzymes [BR:xla01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     397978 (lig1.L)
    6.5.1.6  DNA ligase (ATP or NAD+)
     397978 (lig1.L)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     397978 (lig1.L)
DNA replication proteins [BR:xla03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    397978 (lig1.L)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     397978 (lig1.L)
DNA repair and recombination proteins [BR:xla03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     397978 (lig1.L)
   NER (nucleotide excision repair)
    Other NER factors
     397978 (lig1.L)
   MMR (mismatch excision repair)
    Other MMR factors
     397978 (lig1.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme DDR Glyco_hydro_92
Motif
Other DBs
NCBI-GeneID: 397978
NCBI-ProteinID: NP_001081653
Xenbase: XB-GENE-1009783
UniProt: P51892
LinkDB All DBs
Position
7L
AA seq 1070 aa AA seqDB search
MQRTIKSFFQPKLGAEVKTKEEKVKNDVQKEKEEPEKSVPERPLKERNGRALCGDTESPV
KRVSKKSARVLESDSEEEEENSKVQATPEKMNNESDPKNDVKETPPSARKETPPSARKET
PPSARKETPQSARKETPPSARKDAKSEGASEMNTSQDFVSPCSSKSIDSPLCSDSPGISP
SGIPKRKTARKQLPKRKLEISPSESNPPKDDFDVKGAVKRQKKEAEGDIQQEEPMETSHN
ISMEEECPIKKETNPDVVQETISNADDPNIELVDQKDVVSGEKQSEPKCQEQPQPKLTSP
TVEPKASKGKARKKNSPLPKKVKFSDKVSFKDNDSEEKSNEEKSDEEPQKKADSAKPVKQ
ISSFFAPRKPAIKTEKREENLNEKNVTETSLEESPKPKKNVGSFFGASKQEATEEQTEYN
PSKSKYHPIDDACWCNGQKVPYLAVARTFERIEEESARLKNVETLSNFLRSVIALTPEDL
LPCIYLCLNRLGPAYEGLELGIGETILMKAVAQATGRQLEKIKAEAQEKGDLGLVAESSR
SNQRTMFTPPKLMASGVFGKLKDIARMTGNASMNKKIDIIKGLFVACRHSEARYIARSLG
GKLRIGLAEQSVLSSIAQAVCLTPPGRDAPPTVMDAGKGMSADARKSWIEEKAMILKQTF
CELPNYDAIIPILLEHGIDDLPKHCRLTPGIPLKPMLAHPTKGIGEVLKRFDEAAFTCEY
KYDGERAQIHILENGEVHVYSRNQENNTTKYPDIISRIPKIKKESVKSCILDTEAVAGDA
EKKQIQPFQVLTTRKRKDVDASEIKVQVCVYAFDMLYLNGESLVKEPFAKRRQLLRDSFL
ETEGQFMFATYMDKSNTDEISEFLDQSIKDSCEGLMVKTLEQDATYEIAKRSHNWLKLKK
DYLEGVGDTLDLVVIGAYLGKGKRTGIYGGFLLASYDEESEEYQTICKIGTGFTDDDLEK
HYNFLKDHVIENPRSYYRWDSATEPDHWFDPVQVWEVKCADLSISPVHKAALGLVEDQKG
ISLRFPRFLRIRDDKKPEESTNSFQVADLYRKQQQIQNTSSTEKAEEDFY
NT seq 3213 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgaacaataaagtccttttttcagcccaagctaggggctgaagtaaagactaaa
gaagagaaagtgaagaatgatgttcaaaaggaaaaagaagagccagagaaaagtgttcct
gaacgtcctttaaaagagagaaatggcagagctttatgtggagataccgagtcaccagtc
aaacgagtttcaaagaagtctgcacgtgtgttggaaagtgatagtgaagaggaagaggag
aattcaaaggtacaagcgactcctgaaaaaatgaacaatgaaagcgatccaaagaatgat
gttaaagaaactcctccgagtgcacgtaaagaaactcctccgagtgcacgtaaagaaact
cctccgagtgcacgtaaagaaactcctcagagtgcacgtaaagaaactcctccgagtgca
cgtaaggacgcaaaatctgaaggagcttcagagatgaacacttcccaagattttgtctct
ccttgcagcagcaaatctattgacagccctttatgttcagattctcctggcatatctcct
tccggtatccccaaacgaaagacagcccgtaaacagctaccaaagcgtaaactggaaata
tctcccagtgaatcaaatccaccaaaagatgattttgatgtcaaaggagcagtgaagcga
caaaagaaagaggcagagggagatattcaacaagaagaacccatggagacaagtcacaat
atctccatggaagaggaatgccccataaagaaagagacaaatcccgacgttgttcaagaa
accatatccaacgcggatgatccaaacatagaacttgtagaccaaaaggatgttgtttca
ggagaaaagcaatctgagcctaaatgtcaagagcaaccacagcccaaacttaccagtcct
actgtggagcctaaagcttcaaaagggaaggcaagaaagaaaaacagtcctctgccaaag
aaagtgaaatttagcgataaagtttcttttaaagacaatgacagtgaggaaaaaagtaat
gaggaaaaaagcgacgaggagcctcagaagaaagcagattctgctaaacctgtgaaacaa
ataagcagtttctttgccccaaggaaacctgcaataaagactgaaaagagagaggaaaat
ctgaatgaaaagaatgtcactgagacctctttagaagaatcccctaagcctaaaaaaaac
gttggcagtttctttggagcatccaagcaagaagcaacagaagaacagacagagtataac
ccatccaagagtaaatatcaccccatagatgatgcttgctggtgtaatggacagaaggta
ccttatcttgctgttgcacgaacttttgaaaggatagaagaggaatctgcccgactgaag
aacgtagagactctgagtaattttctgcgctccgtcattgctcttactcctgaggatctc
ttgccttgcatctatctttgtctgaaccgcctgggaccggcatatgaaggactggagcta
ggcataggagaaactattctaatgaaagcagttgcccaggctacaggacgccagcttgag
aagataaaggctgaggcacaagagaaaggagaccttggcctggttgctgagagcagtcgt
agcaaccaacgcacaatgtttacacccccaaagctcatggcatcaggtgttttcggcaag
ctgaaagatatagccaggatgactggcaatgcttctatgaataagaaaattgacattatt
aaaggactgtttgtagcctgcaggcattctgaggcacgttatattgccagatctcttgga
ggaaaacttagaattggtcttgcagaacagtcagtgttatcatccattgctcaggcagtg
tgccttactcctcctgggcgagatgcccctcctactgtgatggatgccggaaagggaatg
agtgcagatgccaggaaatcctggattgaggagaaagcaatgatcttgaaacaaactttt
tgtgagttgccaaactatgatgccataattcctattcttttggaacatggtattgatgac
ctcccaaaacactgccgacttactccaggtatccctctgaaaccaatgttggcgcatcct
accaagggtattggggaagtgttgaagcgatttgatgaagctgcctttacttgtgaatac
aaatatgacggggagcgtgcacagatacatattctggaaaatggggaagtacatgtatac
agcagaaaccaagaaaacaacaccacaaaataccctgacatcatcagcagaattcctaag
attaaaaaagaaagcgtcaaatcctgtatcctcgatacggaagctgtagccggggatgca
gaaaagaaacaaattcagccatttcaagtactgactactagaaagagaaaggatgtggat
gcatcagagattaaagtgcaagtttgtgtgtatgcctttgacatgctttaccttaatgga
gagtccctagtgaaggagccatttgctaagcgacgacagctcttgagagactcgttcctg
gagactgaagggcagttcatgtttgctacatatatggataagtcaaatacagatgaaatt
tctgagtttcttgatcagtctattaaagattcatgtgaaggacttatggtgaagacactg
gagcaagacgctacatatgaaattgcaaagagatctcacaattggttaaaattaaagaag
gattacttggaaggtgtgggtgatactctggatcttgttgttattggagcttaccttggg
aaagggaaaagaactggtatctatggaggcttcttacttgcgtcatacgacgaagaaagt
gaggaatatcagaccatctgcaagattggaacaggttttacagatgacgacttagaaaag
cattacaacttcctgaaggatcatgtgattgaaaatccacggagctactaccgctgggac
agtgccacagagccagatcactggtttgatcctgtacaagtctgggaagttaagtgtgct
gatctatccatttctccagtacataaggcagctcttggattggtggaggaccagaaagga
atttctctgcgatttcctcgttttcttcgtatcagagacgataagaaaccagaggaatcc
acaaacagttttcaggttgcagatctttatagaaagcagcagcaaatccaaaacacaagt
tcaacagagaaggcagaggaggatttttactag

DBGET integrated database retrieval system