KEGG   Xenopus laevis (African clawed frog): 398132Help
Entry
398132            CDS       T01010                                 

Gene name
pax8.L, XPax8, pax-8
Definition
(RefSeq) paired box 8 L homeolog
  KO
K09293  paired box protein 8
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xla03000]
    398132 (pax8.L)
Transcription factors [BR:xla03000]
 Eukaryotic Type
  Helix-turn-helix
   Paired box domain only
    398132 (pax8.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAX Pax2_C HTH_23 HTH_32 HTH_28 HTH_Tnp_IS1
Motif
Other DBs
NCBI-GeneID: 398132
NCBI-ProteinID: NP_001081941
Xenbase: XB-GENE-865008
UniProt: Q9PUK5
LinkDB All DBs
Position
3L
AA seq 465 aa AA seqDB search
MPNSSIRSELTTERGFSGPASNFNIGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVR
PCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMF
AWEIRDRLLTDGVCDNDTVPSVSSINRIIRTKVQQLFNLPMESCVKSLSPGQTLIPSSTV
TPPESPHSDSLGSTYSISGLLGITQPSADGKRKLDDSDQESCRLSIDSQGSVGISRKQLR
TEAYGHHPLDALECHFQRQHFPESYSSSTHSKTEQALYTLPLLNISLDDGKSSLTSTNTT
IGRNLSTHQGYSALSEFTAFSIKQEASDSSSASSTPSSLCSPTFLDLQPINSGCSAPSFS
AFSHPSVYGQFTSHVASGRDVVGATLPGYPPHIPSGQGNYASSAIAGMVAAGGDYSANAY
SHGAYAAYGDSWRFPSSSLLGSPYYYSSGTRTAPPPTTAGAYDLM
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacagcagcatcagatcagagctgaccacagagaggggcttctcaggacctgcc
agcaatttcaatataggtcacggaggtttgaatcagttaggtggggcttttgtgaatgga
cgacctctaccagaggtggtgaggcagcggattgttgacctggcgcaccagggggtacgt
ccctgtgacatctcacgacagctcagagtcagtcatggctgtgtcagcaaaattttgggc
aggtactatgagacaggcagtatccggccaggtgtcattggaggttccaagcccaaggtt
gccacccccaaagtggtggagaaaatcggagattacaaacgccagaacccaacaatgttt
gcctgggaaatcagggaccggctgctgacagacggggtgtgcgacaatgacacagttccc
agtgtcagctctatcaacagaatcatacgcactaaagtacagcaactttttaacctgccc
atggagagctgtgtaaaatctctgagcccaggacaaactctgatccctagttcaacagtg
acaccccctgagtctccccattcagactccctgggatccacgtattccatcagtggtttg
ttggggatcacgcagcccagcgcagatggaaagcgcaaacttgatgacagtgaccaggag
agctgcaggctgagtattgactctcaaggcagtgtggggatcagtaggaaacagctccgt
acggaggcttatgggcaccaccctctagacgccctggagtgtcacttccagagacaacat
tttccggaatcctactcttcttccactcacagcaaaacagaacaggctctatatacccta
cccctgctcaacatttcattggatgatggaaaatcatcactgacttccacaaacaccaca
attggcagaaacctctcgacccaccaaggatattctgctttatctgaattcacagccttc
tccattaaacaagaggcttcagacagctccagtgctagctccaccccttcatctttatgt
agccccaccttcctggatctgcagccaatcaactcaggatgctcagcgccatccttcagc
gcattttcacacccatctgtgtatggccagttcacaagccatgtggcctcaggccgtgat
gtagttggagccacattgccaggatacccacctcacatacccagtgggcaaggaaattat
gcctcctctgcaattgctggaatggtagctgcaggaggtgattactctgcaaatgcctac
agccatggggcttatgcagcatacggagacagttggcgcttccccagctccagccttcta
ggctctccctattactacagctctggcacaaggactgcacctcctcccacaacggcagga
gcctatgaccttatgtag

DBGET integrated database retrieval system