KEGG   Xenopus laevis (African clawed frog): 398148
Entry
398148            CDS       T01010                                 

Gene name
atm.L, Xatm, at1, atdc, atm, tel1, telo1
Definition
(RefSeq) ATM serine/threonine kinase L homeolog
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla03440  Homologous recombination
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04115  p53 signaling pathway
xla04210  Apoptosis
xla04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:xla00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    398148 (atm.L)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    398148 (atm.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    398148 (atm.L)
   04210 Apoptosis
    398148 (atm.L)
   04115 p53 signaling pathway
    398148 (atm.L)
   04218 Cellular senescence
    398148 (atm.L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    398148 (atm.L)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:xla03032]
    398148 (atm.L)
   03400 DNA repair and recombination proteins [BR:xla03400]
    398148 (atm.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     398148 (atm.L)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   398148 (atm.L)
DNA replication proteins [BR:xla03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     398148 (atm.L)
DNA repair and recombination proteins [BR:xla03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    398148 (atm.L)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC HEAT
Other DBs
NCBI-GeneID: 398148
NCBI-ProteinID: NP_001081968
Xenbase: XB-GENE-493814
UniProt: Q5MPF8
LinkDB
Position
Un
AA seq 3061 aa
MSLALHELLLCCRQIETDKATERKKEIVKFRRLLRDPETVQQLDQNSDRRQGKQLNWDTV
FRFLQKYVYKETESIKSAKASVSQATQSNRRKKMQDISCVVKDFIRCANKRAPRLKCTEL
LLHVANTVKDPTSCSAYGTDYSSILLKDILSVRKYWCEITFQQWEDLLTLYFSLYLKPES
TVNRLLVARIIHTLTRGCCQQTDGLHSMFFQFFSKTMKRVGEEKNPPGLDQILAALNVFL
TSASVNCRMRVSKLGEDLFSTVLRIWTMQRPKDALKEEIVEFFRLLLRIHHPKGAKTVDE
GAYAFDPDRWKRNLYSLYDTLVNEISQIGSRGKYSSGSRNIAAKENLVELMADICHQLFT
EDTQVLDITQASFLVTQREPSGAASKRRRIELGWEVLRDNLQKSHNDFDIIPWLQIATCL
IARYPASLPSSELTPLLTVLHQLLAQQRRSERATYVLHCLKEVAVCLKQKTDVKITPKSD
LHKLWPKVWAVTLRSISSPHTEEESFALLASILQGALIPGDTDFWKIFSGAAAKPSNPGV
HCLALALTSYCLPEHISAGFDNPMHEANGSQSSLKEEIIKWLLFGHSDDEVEDTNELSPV
ITKDFSNPALQKILVSLTMKDSRAAMKFFRSLSECSCHNKREDEASFADAEELYLHTSFS
EIPGVPPVGPMEADKDGSSPCLTVNLAIREKLERDLLTLSEQQLNSYSSEAIPPVNLVQC
ACLLTGVLGCYLYADIITEEDALQSHLFQKAKMLMQCAGESTSFLKSKLNEDAKISSLAA
LITQCVGCICNCTKDTPIRFLTDLFLHLFTPRMLNDLTDIGKLLLTSTGSSVETSELDLI
GDDAESRMETEDQGVMDLFDDHCVAEPAENIEYGELQHVTGALSPLSEEHLTKQEAVLLQ
TLEFLCLCTTAAQNHTVNFRPSDTRRKLLALIDNNSLDISKPLHLHVYLLLLNELPKADA
PLPVDEIITLLRPLIEVCSSYRRDQDVCAAILKKLLPVVNCLGQDPMDTEETYDAQGQLL
NVIQAFWILAKDGKYTAVVRASLVNCMKALLKVDPQSKWAILTVDDQDVPVRDAFPAFLA
DSHHQVRFHTAVSISRLFQDVKAQALPLQLQQKAFDNIYLKVQEGMRYLPRSSSDPDEVP
DETWNRRATLLMLISAILRCSPVCEKQALFAICQSVKENGLDPQLIRKELGRVSTALGYR
GVKDFMASHLDYLILEWLRMKVPGYSLSTFPYILLNYSSLNEFYRACYKVLVPHLVIRNE
FEEVKSLAQCIEEDWKLLLADCFPRILVNILPYFASECADDKEMLQKREVATKVYDLLQD
ESCLGKQQIDNLFFRNLPEIVVELLMTLHETSSSHATEDPDLLQFAGELDPAPNPPYFPS
SVIKATLHYISSCHKSKMKSLVTILSKTPDSFQKILLAICNEAAETNNVYKKHRILTIYH
LFVNLLLAEIKDGLGNAWAFVLRDVIYTIIHHINSRPAHGNMDDVSTRSLLLCLDLLHRV
CRAAVTHCEDALECHLHVIVGSLIPLANSQESIQEKVCDLLNFLVIENKDNENLYHTIKL
LDPFPDIPLFKNLRQAHQKIKYSKGPFSLLKEIQNFLSVSACDSLPLTRLEGLNDLRKQL
EQHKDQIKELVRDCQGTPQDSVIASLVVNLLQLSKNAVHQSNGKEVLEAVGSCLGELGPI
DFSTIALQHKKDSVYLKADKVFEEKELQCVLVMLTLINNALTDHRIQVRSAAATCLKNIL
ATKTGAMFWEACKDKGEPMLLYLQPFRAPKKKFLEVEEIQREGALESLDDPGIWIPQNEN
HESWIKHLTCTLLESGGVKSEVLLLLKPMCEVKADFCQAVVPYIVHNILLNDSNQTWRTL
LSKNVQRFFTSCCRSLPSSSRSATPASSDSESEGVTRGAVDIASRRTMLTMVEHLRKQRR
PVSGTAFDDNFWLDLNYLEVAMAVQSCAAHFTALLYSEIYTDKVKQDGEQRTSANRSNAR
KCLKFEEGSQTLDITGLSEKSKEETGISLQDLLMDIYRSIGEPDSLYGCGGGKMLHPLAR
IRTYEHEAKWGKALVTFDLEMNFPPVTRQAGIMQALQNFGLCHMLSTYLRGLEHENAEWS
SELQEIHFQAAWRNMQWDDSLPTKNETSGPGYHEFLYRAVQSLRDKEFCGFHDHIKYARV
KEVEELCSGSLESVYSLYPALCRLQAIGELASVGQMFSRSITDDGLKDTFLKWQRQSQLL
KDSDFEFLEPVLSLRSVILETLLQEEKKQPSQESLKDILTKHLLDLSRIARSAGNTQLPE
KAMFQIKQYNPSQLGVSEWQLEEAQIFWDKEEPSLAREILKQMINKLEIKSFEVENDSRL
RLLYAESLRLCGKWLAETCLESPTVIMQNYLEKAVEFAGYSDGAGEKLQEGRMKAFLSLA
RFSDAQYQRIDNYMKSSEFENKQALLRKAKEEVGLIKHHKVQNNRYTVKVERELQLDECA
ILALIEDRKRFLCKAVDNYISCLVSGEEHDMWIFRLCSLWLENSAVSDVNSMMRQDAQKI
PSHKFLPLMYQLAARMGTKKMGNPGFHDVLNNLIGRISMDHPHHTLFIILALANANKDDQ
LIKAEAVKRSRLTKNAPKQISQLDKERMEAARHIVDTIKKRRTDMVRDVERLCDAYITLA
NMDANQWKSQRNAIPIPSDQPITKLNKLHDVVIPTMEIKVDPSGKYENLVTIVSFKPEFR
LAGGLNLPKIIDCVGSDGKERRQLVKGQDDLRQDAVMQQVFQMCNTLLRRNSETRKRKLT
IRRYKVVPLSQRSGVLEWCTGTVPIGEYLVNDKEGAHKRYRPGDYGSLQCQRKMMEVQRG
RFEEKYQMFLNVCENFRPVFRYFCMEKFLDPAMWFEKRLAYTRSVATSSIVGYIVGLGDR
HVQNILIDEESAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCC
EKTMEVMRNNQEALLTIVEVLLYDPLFDWTMNPLKALYLQQDEVDLNATLGGDDPECNRN
SCDSQSVNKVAERVLLRLQEKLKGVEEGMVLSVGGQVNHLIQQAMDPKNLSSLFPGWKAW
V
NT seq 9186 nt   +upstreamnt  +downstreamnt
atgagtcttgcgctacatgagctgctgctctgctgccggcagatagaaactgacaaggcc
actgaaagaaagaaagaaatcgtgaagtttcgaagacttcttcgagatccagaaaccgtt
cagcagttagatcagaactctgacaggcggcaaggcaaacaactcaattgggatacagtg
ttcaggtttttgcagaaatatgtctacaaagagacagaaagcattaaatctgcaaaggcc
agtgtttctcaggctacacaaagcaatcgacggaagaagatgcaagacattagttgcgtg
gtcaaagatttcatccgatgtgcaaataagcgagccccaaggttaaaatgcacagagctt
ttattgcatgtggccaacactgtgaaagacccaacatcatgttctgcttatgggacagac
tatagcagcatcttgctaaaagatatcctgtctgtccgcaaatattggtgtgagataact
ttccagcaatgggaagacttactgacgctctacttcagcttgtacctgaaaccagagagc
actgtgaaccgcttgttggttgcaagaattattcacactctgaccagaggatgctgccag
cagacagacggacttcactccatgttcttccagttcttctcaaagacaatgaagagagtc
ggggaagagaaaaatccacctggtctggaccagatcctcgctgctctgaatgtgttcctt
accagcgcctccgtgaattgccgtatgcgagtgagcaagctgggggaagacctgttctcg
actgttcttcgaatctggacaatgcaaaggcctaaagatgcactcaaggaggagattgtg
gagttctttaggttgcttctcagaattcatcatcctaaaggagccaagactgtagatgaa
ggtgcttatgcttttgatccggacagatggaagaggaacttgtacagcctatatgacact
ctggtaaatgagatcagccagataggcagcagagggaaatattcctcaggctcccgaaac
attgcagccaaggaaaacttggttgagttgatggcggacatttgtcatcagctgttcact
gaagacactcaggtgctggatatcacacaggcttctttcctcgtgacccaaagggaaccg
tctggagccgccagcaaacgcagaaggattgaacttggatgggaagtgctccgtgacaac
cttcagaagtcacataatgattttgatatcattccttggttacaaattgcgacctgcttg
atcgctcgatacccagcgagcttgcctagcagtgagctgactccattactgaccgttcta
caccagttacttgcccagcagagacgaagcgagagggctacctatgtgcttcactgcctg
aaagaggtcgctgtttgtctaaagcaaaaaacagatgtgaaaatcacaccaaagtccgat
ctgcacaagctgtggcctaaagtctgggctgttaccctgcgcagcatcagttctcctcat
acagaagaggaaagctttgctctactggcttccatcttacaaggagctttaataccggga
gacacagatttctggaagatcttttcaggagctgctgctaaaccgtcaaaccctggggta
cattgcttggctctggccctgacgtcctattgtctcccggagcacatcagtgcgggtttc
gataatcccatgcatgaagccaatggcagtcaaagctccctgaaagaagaaatcataaaa
tggttattgtttggtcactcggatgatgaagtggaagacaccaatgagctttctccagtt
ataaccaaagacttttccaaccctgctcttcagaaaattcttgtgagcctgacaatgaag
gactccagagctgctatgaaatttttcagaagcctttcagagtgctcatgccataacaaa
agggaagatgaagccagttttgcagatgcagaagaactatacttgcatacctcatttagt
gagattccgggggtgcctcctgtgggtccaatggaagctgacaaagatggaagctctccc
tgcctgactgtgaatttagctataagagagaaactggagcgagacctgctcaccctatct
gagcagcaactcaactcctactcctctgaggccattccgcctgtcaaccttgtccaatgc
gcttgtctgttgactggggtcttgggttgttacctgtacgcagatattatcactgaggag
gatgctctccaatcccatttatttcaaaaagccaagatgctgatgcagtgtgctggggag
agcacttcattcctgaaatctaaactgaatgaggacgccaagatcagctccctggcagcg
ctgataactcagtgtgtgggctgtatatgtaactgtacaaaggacactcccattcggttc
ctcacagatctttttctacatctttttaccccaagaatgttaaatgacctgacagacatc
ggtaaacttttactaaccagcactggcagctcagtagagaccagtgagcttgatctaata
ggagatgatgccgaatccagaatggaaacagaagatcagggagttatggacctatttgat
gatcactgtgttgctgaaccagcagaaaacatagagtatggagagcttcagcatgtcact
ggtgcattgagccccctgtctgaggagcatctcaccaaacaagaagctgtcctgctgcag
accctcgagttcctttgcctttgtaccactgctgctcagaatcacacagtcaacttccga
ccttctgatacccgcagaaagctgttagccctgattgataataactctttggatataagc
aaacccctgcacctacatgtgtacttactgctcttaaatgaactgcccaaagctgacgct
ccactgcctgttgatgaaatcattactttgctgaggccactaattgaagtgtgttcttcc
taccgccgagaccaggatgtctgtgcagcgatactaaagaaactgctccctgtggtcaac
tgtttggggcaagacccgatggacacagaggaaacatacgatgctcaggggcaactcctg
aatgttattcaggcattctggattttagcgaaggatggaaaatatactgcagtggtccgt
gcatctctggtgaactgcatgaaggccctactcaaggttgatccacagtctaagtgggca
attcttacagttgatgaccaggacgttcctgtgagagacgcgtttccagcatttctggcg
gactctcatcaccaggttcgctttcatactgcagtgtccataagcagattgttccaggat
gtaaaagcacaagcccttcccctacagctacagcagaaggcatttgataacatctacctg
aaggttcaagaaggaatgcgctatctgcctcgcagcagctctgacccagatgaggtccct
gatgagacctggaaccgaagggcgacgttgctgatgttgatatcggcgattctgcgctgc
agtccagtgtgtgagaagcaggctctgtttgccatctgtcagtctgtgaaagagaatggg
ttggaccctcagcttatcagaaaggaactaggcagggtttctactgctctgggatacaga
ggtgtaaaggatttcatggcttcccatttagactatctgattcttgaatggctgagaatg
aaggttcctgggtacagtctatccacgttcccatacatcttgctaaattactcctctctc
aatgagttttacagagcctgttacaaagttcttgtccctcatctggtgatacggaatgaa
tttgaagaggtgaagtcccttgctcagtgcatcgaggaggactggaagcttctgcttgct
gattgctttcccagaattctagtcaacatcctcccttactttgcctctgaatgtgctgat
gataaagagatgctgcagaagagagaggttgctactaaagtgtatgacttgctgcaggat
gagagctgtttgggcaagcagcaaatcgacaacttgttcttccgaaaccttccagagatt
gtggtggagctgctgatgacacttcatgaaacttccagcagccatgccacagaagaccct
gatctgctacagtttgcaggggaactggatccagccccaaatcccccttattttccatca
tctgttatcaaggcaactttgcactacatcagcagctgccacaaaagcaaaatgaaaagt
ctagtgacaatactgtccaagaccccggattcctttcagaagatattgctggctatatgc
aatgaggcggcagaaacaaacaacgtgtacaagaagcaccgcattctcaccatctaccac
ctgtttgtcaatctgcttcttgcggaaattaaagatggtcttggcaatgcttgggcattt
gttctaagagacgtcatttacaccataatccatcacatcaacagcagacctgcacacggc
aatatggatgacgtatctacacgcagtctcttgctttgcctcgatctgttgcaccgagtc
tgccgagctgctgtcactcactgcgaagatgctttagagtgtcacctccatgtcattgtg
ggcagcctgatacctttggcaaacagccaggaaagcattcaagaaaaggtgtgcgacttg
ctgaactttctggtgatagaaaacaaggacaatgagaatctctatcataccattaaactt
ttggatcctttccctgatattcctctctttaagaacctgcgccaggcccatcagaaaatc
aaatacagcaaaggtccattctcgctcctaaaggaaattcagaattttctctctgtcagc
gcctgtgactcccttccactaaccagactagaaggactgaatgacctgagaaaacaatta
gagcaacataaggatcagataaaagagcttgtgagagattgccaaggaaccccccaggac
agtgttatagcaagtctagtagtgaatctgttacagctctccaaaaatgcagtgcatcag
tctaatgggaaagaggttctggaagctgttggcagttgccttggagaactaggacctatt
gacttctctaccatcgctctgcagcacaagaaagattctgtttatctaaaagcagacaaa
gtctttgaagaaaaagagcttcagtgcgttctcgtcatgctgacattaataaacaatgcc
ctgacggatcaccgcatccaggttcgatcggcagctgccacctgtttaaaaaatattttg
gccacgaaaaccggtgccatgttttgggaggcctgtaaggacaaaggagaaccaatgctt
ctctatctccaaccgttccgtgctccgaagaaaaaatttctggaagtggaagaaattcag
agagaaggtgctttggaaagcctggatgaccctggtatctggatcccacagaatgaaaac
catgagagttggataaaacatctgacttgcactttgctggagagcggaggggtaaagagt
gaagtacttctcttgctaaagcccatgtgtgaggtgaaagcagatttctgtcaggcagtg
gtgccgtacatcgtacacaacattcttctgaatgactccaatcaaacatggaggactctt
ctgtcaaagaatgtccagaggtttttcacttcatgttgccgatctctgccgagttccagc
agatcagctacaccagcgagttctgattcagaatccgagggagtgacacgaggggccgtg
gatattgcttccaggaggacgatgctcaccatggtggaacacttgcgcaaacaaaggagg
ccggtgtcaggaacagcatttgatgataatttctggttggacttaaactacctagaagtg
gcaatggctgtccagtcctgcgcggcgcacttcactgctttgctctactccgaaatctac
accgataaggtcaaacaggacggcgagcagcgcacgagcgcaaacaggtccaatgcacgc
aaatgcctgaaatttgaagaaggaagtcagacattggatatcactggcctgagtgagaaa
agcaaagaggagactgggataagcttacaggatctattgatggatatctacaggagcatt
ggagagccggacagcttgtacggctgcggtggtggaaaaatgctccatcctcttgcaaga
atccgcacttatgaacatgaggccaaatggggaaaagcactggtgacctttgacctggaa
atgaacttcccgccagtcacccgccaggcagggattatgcaggctttacagaactttggc
ctctgccatatgctctccacgtatttacgagggctcgaacacgaaaacgcagaatggtcc
tcggaactgcaggaaatccatttccaggccgcctggaggaacatgcagtgggatgacagt
ttaccaacaaagaacgagacctccggacctggttaccacgaatttctgtatcgggccgta
cagtcactgagagacaaggaattctgtggctttcacgatcatataaaatatgccagggtt
aaggaggtggaagagctatgcagcggcagcctggaatctgtgtactctctctaccccgca
ctgtgtaggctacaagctatcggggaacttgcaagtgtggggcagatgttctccaggtcc
atcactgatgatgggttaaaggatactttcttaaagtggcagaggcaatcccaactccta
aaagacagtgattttgaattccttgagcccgtcctgtccctacggtctgtgattttggaa
accctgctgcaggaggagaagaagcaacccagccaggagagcctgaaggacatcctaact
aaacacctgctggatttatccagaatagctcggagtgccggaaacacacagcttccagag
aaagccatgtttcagatcaagcagtataaccccagtcagctcggtgtatctgaatggcag
ctggaagaggctcagatcttctgggataaagaggagccaagcttagcacgggagatcctc
aaacagatgattaataagctggaaataaagagctttgaggttgagaatgattccaggctt
cgcctgctctatgctgagagtctgaggttatgtggaaagtggctggcagaaacctgcttg
gagagtcccacagtcatcatgcagaattatctggaaaaggctgtggaatttgctggatac
tctgacggggctggagaaaagctgcaggagggcagaatgaaggccttcctgtctctagct
cgcttttccgatgcccagtatcagaggattgacaactacatgaagtcctctgagtttgag
aacaaacaggccttgctgagaaaagccaaggaggaagttggtctaataaagcaccacaag
gttcagaataataggtacacagtgaaggttgagcgagagctacagttggatgaatgtgct
attttggccctgatagaggacagaaagcggttcctgtgcaaagcagtggataactatatc
agctgtcttgtttctggggaggaacacgacatgtggatctttcgcctgtgctccctctgg
ctggagaattcagcagtgtcagatgtgaacagtatgatgaggcaagatgcccagaagatc
ccatcccacaagttcctgcctctgatgtaccaactggcggctcgtatgggcactaagaag
atgggaaacccaggatttcacgacgtccttaataatctgattggtaggatttccatggac
cacccacatcacacgctgttcattatcctggctctggccaatgcaaataaagacgatcag
ttgataaaagcggaggctgtgaaacggagccggctcaccaagaatgcccccaaacagatc
tcccagcttgataaggaacggatggaagccgcccgtcacattgtcgacacaataaagaag
cggaggaccgacatggtgcgagacgttgagagactctgtgatgcgtatataacccttgcc
aacatggacgccaaccagtggaaatctcagagaaatgccattcccatcccatcagatcaa
cccatcactaaactgaataaactacatgatgttgttattccaactatggagatcaaggtc
gaccccagtgggaagtatgaaaacctggtgacaattgtgtctttcaaacccgagttccgc
ctggccgggggccttaatctccccaaaataattgactgtgtcggctctgatgggaaagag
aggagacaacttgttaagggtcaagatgacctgagacaagatgcagtcatgcagcaagtg
ttccagatgtgcaatacattgttacggcgcaacagcgagacgaggaagagaaagctcact
atccgcaggtacaaggtggttcccttgtcccagagaagtggagtgctggagtggtgcacc
gggaccgttcccattggagaatatcttgtcaatgacaaagaaggtgcacacaaacgttac
cgcccaggggattatggcagtttgcagtgtcaaaggaaaatgatggaggtgcagagagga
cgcttcgaagagaagtaccagatgtttctcaacgtttgtgagaatttccgcccagtcttc
cgctatttctgcatggagaaatttctggatccggccatgtggtttgagaaacgtttggcc
tacactcgcagcgtggccacgtcctccatagttggatacattgtcgggcttggagacaga
cacgtccagaacatcctaatagatgaggagagcgctgaactcgtacacattgacttagga
gtggctttcgagcaggggaaaattctgcccacgcctgaaactgttcccttccggctcaca
agagatatagtggatgggatgggcattactggagttgaaggggtattcagaaggtgctgt
gagaagaccatggaagttatgaggaacaaccaagaagctctgctgaccattgttgaggtt
ctactctatgacccactctttgattggacaatgaatcccctcaaagctttgtacttgcaa
caggatgaagtggatctcaatgccacccttggtggtgatgacccagaatgcaacagaaat
tcatgtgacagccagagcgtcaataaagtggcagaacgtgttctccttcgccttcaggaa
aagctcaaaggagtagaagaggggatggttctgagtgtggggggacaagtcaatcatctt
atccagcaggccatggacccaaagaatctcagcagtctattccctggatggaaggcctgg
gtataa

DBGET integrated database retrieval system