KEGG   Xenopus laevis (African clawed frog): 398179
Entry
398179            CDS       T01010                                 

Gene name
chek2.L, cds1, chek2, chk2, hucds1, lfs2, pp1425, rad53
Definition
(RefSeq) checkpoint kinase 2 L homeolog
  KO
K06641  serine/threonine-protein kinase CHEK2 [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04110  Cell cycle
xla04115  p53 signaling pathway
xla04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    398179 (chek2.L)
   04115 p53 signaling pathway
    398179 (chek2.L)
   04218 Cellular senescence
    398179 (chek2.L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    398179 (chek2.L)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:xla03400]
    398179 (chek2.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     398179 (chek2.L)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: CAMK group
  RAD53 family
   398179 (chek2.L)
DNA repair and recombination proteins [BR:xla03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    398179 (chek2.L)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr FHA Kinase-like YrbL-PhoP_reg Kdo Pkinase_fungal
Other DBs
NCBI-GeneID: 398179
NCBI-ProteinID: NP_001082016
Xenbase: XB-GENE-5765457
UniProt: Q9I8V3
LinkDB
Position
1L
AA seq 517 aa
MMSRDTKTESQQSQGTSSSSSSSAPQSYSQSSSSGTLSSLDTVPVQDLASIPEDPEIDED
IPQPWGRLWALGKGFLNHDCLHEEYVFGRDKKCDYTFDIPVLNQTDRYKTYSKRHFRIFQ
ELGHGHSRVANIEDLSGNGTFVNKEIIGKGRTLPLTNNAEIALSLPTNKVFVFSDLSVDD
QTIYPKDFIDKYIMSRPIGSGACGEVKLAFQKSVCKKVAVKIISKRKFKMNTSSNEHPIS
VDTEIEILKKLDHPCIIKIENFFDSEDFYYIVLELMEGGELFDRVVNSTRLREPIAKLYF
YQMLLAVQYLHENGVIHRDLKPENVLLSSTSEECCIKITDFGQSKILGETSLMRTLCGTP
TYLAPEVLNTAGTTGYSSAVDCWSLGVILFVCLCGYPPFSEQNSNIPLKNQIAEGKYTYI
AAAWRNVSEQAFDLVKNLLVVDPEQRLTTKQALEHPWLQDDSMKHTVERLMYGVDHTMPP
PIKKNIIRKRGHEWDQDASTSSCSEILPTSAEKRAKR
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgatgtctcgtgatactaaaacagagtcgcaacaatctcagggcacttcaagttcctcg
tcctccagtgctcctcaatcttacagtcagtcgtcttcatcgggtacattaagttctttg
gatactgttccagtgcaagatcttgcgtccattcctgaagaccctgagatagacgaggat
ataccccagccttggggtcgtctctgggctcttgggaagggctttctaaatcatgattgc
ctgcatgaagaatatgtatttggaagagacaaaaaatgtgattacacctttgatattcca
gtactaaaccagaccgacaggtacaaaacatatagcaaaaggcacttcagaatatttcag
gaattaggtcatggacactcccgtgttgctaacatagaagatctgagcggcaacggaaca
tttgttaacaaggagattattggaaaagggcggacattgcctttaacaaataatgccgag
attgcactttcattaccaactaataaagtttttgttttttcagatttgtctgtggatgat
cagactatatatcctaaggacttcattgataaatacatcatgtcaaggccaatcggaagt
ggggcttgcggggaagtgaaattggcttttcaaaagtcagtatgcaagaaggttgctgta
aaaatcatcagtaaaagaaaatttaaaatgaacacttctagtaatgaacaccctatatct
gttgacacagaaatagagatcctgaaaaaacttgatcatccctgtatcattaaaatagag
aatttttttgactctgaggacttctattacattgtgttggaactgatggaaggaggcgaa
ctgtttgacagggtggtaaattcgacaagactccgagaaccaattgccaaactgtatttt
tatcagatgctgctagctgttcagtacctccatgaaaatggggtgatacatcgtgatctg
aagcctgaaaatgtgctgttgtcatccactagtgaagaatgttgcataaagataacggat
tttggacagtcaaaaattctgggtgaaacgtctttaatgagaactttgtgtggaactcct
acatacttggcgcctgaagttttgaatacagcaggcacaactggatacagtagtgcagtg
gattgctggagtttaggagtcatcctttttgtgtgtctttgtggatatccccccttttca
gaacaaaatagtaacattcccttgaaaaatcagattgcagagggaaaatacacctacatt
gctgctgcttggagaaatgtatcagaacaagcatttgatttagtcaagaatcttcttgtt
gttgatcctgagcaaagacttaccactaaacaagcactggaacatccctggcttcaggac
gattctatgaagcatactgttgaaaggttaatgtatggggttgaccacacaatgcctcct
ccaatcaagaaaaacataattcgaaaacggggacatgaatgggatcaagatgccagtact
tcatcttgctcagagatattaccaacatcagccgaaaagagagcaaaaagataa

DBGET integrated database retrieval system