KEGG   Xenopus laevis (African clawed frog): 398197
Entry
398197            CDS       T01010                                 

Gene name
atr.L, XATR, atr, frp1, mec1, sckl, sckl1
Definition
(RefSeq) ATR serine/threonine kinase L homeolog
  KO
K06640  serine/threonine-protein kinase ATR [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla03460  Fanconi anemia pathway
xla04110  Cell cycle
xla04115  p53 signaling pathway
xla04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:xla00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    398197 (atr.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    398197 (atr.L)
   04115 p53 signaling pathway
    398197 (atr.L)
   04218 Cellular senescence
    398197 (atr.L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    398197 (atr.L)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:xla03400]
    398197 (atr.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     398197 (atr.L)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   398197 (atr.L)
DNA repair and recombination proteins [BR:xla03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    398197 (atr.L)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT UME FATC FANCI_HD1
Other DBs
NCBI-GeneID: 398197
NCBI-ProteinID: NP_001082049
Xenbase: XB-GENE-1012725
UniProt: Q9DE14
LinkDB
Position
5L
AA seq 2655 aa
MATDPGLEMASMIPALRELASAGAEEYNTTVQKPRQILCQFIDRILTDVDVVAVELSKNT
DSQPSSVMLLDFIQHIMKSTPLMFLSANNGDQSAETNQNCVAFSNWIISRLLRIGATPSC
KALHRKIAEVIRSLLFLFKNKSSFLFGVFTKDLLHLFEDLIYIHEQNMEKSVVWPVTISR
FLSNASENQTYLRCTQFQLLNMQNIEPLESTLLMVLMDNEHDISPVFFQRQNLLLWGIGC
SLLDYGSTPLKIQALHFLRQLIKLGGPPEQGAYFFFIVFFGILTCIKDMDLEEVSLYEMP
LLKLVKVLFPFESKSYLNIEPVYLNMLLEKLAALFDGGILSNIQSAPLKEALCYMVHYFL
SIVPPGYESAKEVREAHVRCICRAFVDVLGLQSKQEYLVCPLHEALRIENLVFMQQQRMQ
PLSTDSEGGGSSSSSDEVQEKRPRLSLTAKPLRRNTPSVPAPVDMKTKSILWKAVSAKFS
SILCKLEGDEVTDEEMVSLLEGLNTTVRVAALNTVHIFTNNSTDTDQLVSDLSNTSGIQS
VEIVPHVFWLSPEDILKILKICRKVLDSAHQRANINDILMKIIKIFDAILYIHAGNRLND
QTLKDLCSMISLPWLQNHSNHASFKVASFDPTLMTISERIGQHYSPEIQSQLVFLLCLFP
KMLCPEWRLAVYQWALDSPHEIVRARCIKGFPVLLCNVSQQGYGPIPKILIDCLNDASEL
VKKELANSVGMFASGLACGFELQYSPTAPTAAESEFLCSSLTVTALPSSKLSRMTASALK
PFLALLNRNMPSSVKMAFIENMPMLFAHLSLEKDDLDSRTVIESLLNLMEDPDKDVRTAF
SGNIKHLLACADCEDGYLKEIVVSRMKKAYTDAKMSRDNEMKDTLILTTGDIGRAAKGEL
VPFALLHLLHCLLSKSPCVAGASYTEIRSLAAAKSTSLHIFFSQYKKPICQFLIESLHSS
QAALLTNTPGRSSEMQKQEATHHREAALDILSEIANVFDFPDLNRFLTRTLQLLLPYLAA
KASPTASTLIRTIAKQLNVNRREILINSFKYIFSHLVCSCTKDELEKSLHYLKNETEIEL
GSLLRQDYQGLHNELLLRLGEHYQQVFSGLSILATYASNDDPYQGPRNFAKPEIMADYLQ
PKLLGILAFFNMHLLSSSIGIEDKKMALNSLVSLMKLMGPKHISSVRVKMMTTLRTGLRY
KEEFPGLCCSAWDLFVRCLDQAYLGPLLSHVIVALLPLLHIQPKETVAVFRYLIVENRDA
VQDFLHEIYFLPDHPELKEIQKVLQEYRKETTKSTDLQTAMQLSIRAIQHENVDVRMHAL
TSLKETLYKNQAKLLQYSTDSETVEPVISQLVTVLLIGCQDANPQARLFCGECLGQLGAI
DPGRLDFSPSETQGKGFTFVSGVEDSDFAYELLTEQTRAFLAYADNVRAQDSAAYAIQEL
LSIFECKEGRTDCPGRRLWRRFPEHVQEILEPHLNTRYKSSRKAVNWSRVKKPIYLSKLG
NNFADWSATWAGYLITKVRHELARRVFSCCSIMMKHDFKVTIYPLPHILVYVLLGCNKED
QQEVYAEIMAVLKHEDPLMRRLQDSASDLSQLSTQTVFSMLDHLTQWAREKFQALNAEKT
NPKPGTRGEPKAVSNEDYGEYQNVTRFLDLIPQDTLAVASFRSKAYTRALMHFESFIMEK
KQEIQEHLGFLQKLYAAMHEPDGVAGVSAIRKKEASLKEQILEHESIGLLRDATACYDRA
IQLKPEEIIHYHGVVKSMLGLGQLSTVITQVNGILNSRSEWTAELNTYRVEAAWKLSQWD
LVEEYLSADRKSTTWSIRLGQLLLSAKKGERDMFYETLKVVRAEQIVPLSAASFERGSYQ
RGYEYIVRLHMLCELEHSVKMFLQKPSVEPAVDSLNLPARLEMTQNSYRAREPILAVRRA
LQTINKRPNHADMIGECWLQSARVARKAGHHQAAYNALLNAGESRLSELNVERAKWLWSK
GDVHQALIVLQKGAELFLSSTSAPPEQQLIHGRAMLLVGRLMEETANFESNAVMKKYKDV
TALLPEWEDGHFYLAKYYDKLMPMVTDNKMEKQGDLIRYIVLHFGRSLQFGNQYIYQSMP
RMLSLWLDFGAKVYEWEKAGRADRLQMKNELMKINKVISDHKNQLAPYQFLTAFSQLISR
ICHSHDEVFAVLMEIVAKVFVAYPQQAMWMMTAVSKSSYPMRVNRCKEILEKAIHTKPSL
GKFIGDATRLTDKLLELCNKPVDGNTSTLSMNIHFKMLKKLVEETTFSEILIPLQSVMIP
TLPSTAGKRDHADHDPFPGHWAYLSGFDDAVEILPSLQKPKKISLKGSDGKSYIMMCKPK
DDLRKDCRLMEFNSLINKCLRKDAESRRRELHIRTYAVIPLNDECGIIEWVNNTAGFRNI
LIKLYKEKGIYMGGKELRQCMLPKSAPLQEKLKVFKEALLPRHPPLFHEWFLRTFPDPTS
WYNSRSAYCRSTAVMSMVGYILGLGDRHGENILFDSLTGECVHVDFNCLFNKGETFEVPE
IVPFRLTHNMVNGMGPMGTEGLFRRACEVIMRLMREQRESLMSVLKPFLHDPLVEWSKPA
RGSSKGQVNETGEVMNEKAKTHVLDIEQRLQGVIKTRNRVKGLPLSIEGHVHYLIQEATD
ENLLSQMYLGWAPYM
NT seq 7968 nt   +upstreamnt  +downstreamnt
atggctactgaccccggtcttgaaatggcctctatgatcccggccttgcgtgaacttgcc
agtgccggggcagaggaatataacacaactgttcagaaaccaagacaaatcctttgccag
tttatagaccggattctgacagatgtggacgttgttgctgtggagctttcaaagaatact
gattctcagccaagttctgtgatgttgctggattttattcaacacattatgaaatctacc
ccattaatgtttctcagtgcaaataacggtgatcagtctgctgaaaccaatcagaactgt
gttgcatttagcaactggatcatttcccggctcttacgcattggggctacgccaagctgc
aaagctttgcatagaaaaatcgctgaagtcatccgctccctgctttttcttttcaaaaac
aagagttcctttctatttggtgtttttactaaagatttattacatctctttgaagatctt
atctacatacatgaacaaaacatggagaaatccgtagtttggcctgtgaccatttctaga
tttttaagcaatgcatcagaaaaccaaacttacttaagatgcactcaatttcagttgttg
aacatgcagaacattgagcctttagaatccactctgctaatggttttgatggataacgaa
catgatatttctccagtgtttttccaaaggcagaacctcctcctctggggcattgggtgc
tccctcttggactatggaagtacaccactgaagatacaggcattgcattttttaagacaa
ctaataaaattaggtggtccaccagaacagggtgcatattttttcttcattgtgtttttt
gggatactaacttgtataaaagacatggatttagaagaagtgtctctttatgagatgcca
ctgttgaaattggtaaaggttttgttcccatttgaatcaaaatcttacctaaacattgaa
cctgtctatctgaatatgttgctggagaaacttgctgctctctttgatggaggtatcttg
agtaatattcagtcagctcccttgaaagaagctctttgctatatggtccattacttcctt
agcattgtgcctccgggctatgaatctgccaaagaagtccgagaggcacatgttcgctgc
atctgtagagcttttgttgatgtccttggacttcagagcaagcaagaatacttggtctgc
ccccttcatgaagcattaagaatagaaaacctggtgttcatgcagcagcagcgcatgcag
cccctaagcacagactcagagggtggtgggagcagcagcagcagcgatgaagtgcaagag
aaacgaccacgtttgagtctaactgcaaagcctctaagaagaaacacaccatcagtgcct
gctcctgtggatatgaagacaaagagcatactatggaaagcagtgagtgcgaaattctcc
tctattttgtgcaaactggaaggtgacgaagttacagatgaagagatggtttctttattg
gagggtcttaatacaactgtacgtgttgctgctctcaatacagttcatatcttcactaat
aattccacagatactgatcagttagtatctgacttgagcaatacttctggcattcagtcg
gtagaaatagtacctcacgtgttctggctcagtccagaggatattctaaaaatacttaaa
atttgtagaaaggttcttgattctgcacaccagagagccaatataaatgacattctgatg
aagataataaaaatatttgatgcaatactctacattcatgcaggaaacagattaaatgac
caaactcttaaggatttgtgcagcatgatctcattaccctggcttcagaatcattcaaat
catgcttcctttaaagtggcatcatttgacccaacattgatgaccataagtgagcggatt
ggccaacattactcacctgaaattcagtctcaacttgttttcctcctgtgcctgtttcca
aaaatgttatgccctgagtggagattagctgtgtaccaatgggcattggatagcccacat
gagattgttcgtgcccgttgcatcaaaggattccctgttcttctgtgcaatgttagccag
caggggtatggtccaattcccaagattttaatcgactgtttgaatgatgcctctgagctg
gtgaagaaggagttagccaactcagtgggtatgtttgcctccggccttgcttgcggtttt
gagctgcaatattccccaacggcacctactgcagcagaatctgagttcctttgtagcagc
ctgacagttactgctttaccctcatcgaaactttctcgtatgaccgcctctgcattaaaa
ccattcctggcactgcttaatcgaaacatgccaagctccgtcaaaatggcatttattgaa
aatatgcccatgctgtttgctcacctctctcttgagaaagatgatttggattcccgaact
gtgattgaatcattgttaaacctaatggaggacccagacaaggatgtaaggacagctttc
agtgggaacatcaaacacctgttggcgtgtgcagactgtgaggacggatatctaaaggag
attgtagtctcaaggatgaaaaaagcatatacagatgccaagatgtcgcgtgacaatgag
atgaaggacactctcattcttacaactggggatataggaagggcagcaaaaggagagttg
gtaccatttgcactgttgcatctgctgcattgcctgctgtctaaatccccatgtgtggca
ggtgcttcttacacagaaatccgatctcttgcagcagcaaagtccaccagtctgcatatc
ttttttagccagtacaagaaaccgatttgtcagttccttatagaatcgcttcactcaagc
caggcagcccttctgaccaacacacctggccgcagcagtgaaatgcagaagcaggaggca
acacatcatagggaagctgcacttgacatcttatccgaaatagcaaatgtatttgatttc
ccagacttaaaccgctttttaacgaggactttgcaacttttgcttccatatcttgctgcc
aaagctagtccaacagcctctactctgataagaacgattgccaaacaacttaatgtgaat
cgaagggagatcctgatcaatagcttcaagtatatattctctcacttggtttgttcttgc
acaaaagatgagctggaaaagtcgcttcattacctaaagaatgaaacagaaattgagctg
ggtagtttactgagacaggactaccagggactgcacaatgaactacttttgcgcctgggt
gagcactatcagcaggtctttagtgggctgtccatattagcaacatatgcatccaacgat
gatccatatcagggacctaggaattttgcaaagccagaaataatggcagattatttgcaa
ccaaagcttttaggaattttggctttctttaatatgcacctgttgagctccagcattggc
attgaagacaagaaaatggccttgaacagtctggtttctttaatgaaactgatgggacca
aagcatataagttccgttagggtcaagatgatgacgaccttgagaactggcctacgttat
aaagaggaatttccggggctttgctgcagtgcatgggacttgtttgttcgctgcctggat
caagcctatctgggcccgctcctcagtcatgtgattgttgcactgctgcctctgttgcac
atccagcctaaagaaactgttgctgtgttccgctatctcatagtagagaacagggatgct
gttcaggatttccttcatgaaatatattttctgcctgatcatccagaattgaaagaaatc
cagaaggttctacaagaatacaggaaagaaaccaccaaaagcacagatctgcagacagcc
atgcagctgtctattcgagccattcagcatgaaaatgtggatgttcgcatgcatgccctt
actagtctgaaagaaacactctacaagaaccaggctaaactgttgcagtattcaacagac
agtgaaactgtagaaccagttatctcccagctggtaacagttctcttaattggatgccaa
gatgccaatccacaagcccgtctattttgtggtgaatgccttggccaacttggagccatt
gatcctgggagattggatttctcacccagtgaaacacaagggaaaggttttacttttgtt
tcaggagttgaagattcagactttgcctatgagttgctcacagagcaaactagagcattt
cttgcctatgctgataatgtccgcgcccaggactctgctgcctatgctatacaggagctt
ctctctatcttcgagtgcaaagaaggaaggactgattgtcctgggcgtaggctgtggagg
agattcccagaacatgttcaagaaatattggagccgcatcttaatactagatacaagagt
tccagaaaggctgtaaactggtccagagtgaaaaagcccatttatttgagcaagttagga
aataactttgcagactggtcagcaacatgggcaggttacctcataactaaggttcgacat
gagcttgccaggagagttttcagctgttgtagtataatgatgaagcatgacttcaaagtg
accatttatccgctcccacatattttggtctatgttttgttgggatgtaacaaagaagat
cagcaagaggtatatgcagaaattatggcagtgttaaagcatgaagatccactaatgcgt
cggttacaggacagcgcctcagatctgagtcagctcagcacccaaacagtcttttcaatg
cttgatcatcttactcagtgggcacgggagaaattccaggcactaaatgctgagaaaaca
aatcccaaaccaggaaccagaggggaaccaaaggcagtgtctaatgaagactatggagag
tatcagaatgtaacaaggtttttagatcttataccgcaggatactttggctgttgcttcc
tttcgttccaaagcttatactagagctctcatgcattttgaatcctttataatggaaaag
aaacaagaaattcaggagcaccttggatttctacagaaactgtatgctgctatgcatgag
ccagatggagtagctggggtaagcgccattcgcaagaaagaagcttctctgaaagaacag
atcttggagcatgaaagtattggtctgttgagagatgccactgcttgctatgatagagct
attcagctaaagcctgaggagataattcactatcatggggtagtgaaatctatgcttggt
cttggccagttgtctactgtaattacgcaagttaacggcattttgaatagcaggtcggaa
tggacagctgagctaaacacatacagagtagaagcagcatggaaactctcacagtgggat
ttagtggaggaatacttatctgcagacagaaaatctaccacatggagcattaggctgggg
caactcctgctttcagctaaaaagggtgagagagatatgttttatgaaacgctcaaagta
gtgcgagccgaacaaattgttccactgtctgctgccagctttgagaggggctcctaccaa
cgaggatatgagtacatagtaaggttgcacatgttatgtgagctagagcacagtgtaaaa
atgtttcttcagaaaccttctgttgagcctgcagtagactctttgaacctgccagcacgg
ctagaaatgacacagaattcctacagagcaagagagcccattttggcagttcgcagggca
ctacaaacaatcaacaaaaggcctaatcatgcagatatgattggtgagtgttggctgcaa
agtgctcgagttgcgcgtaaggctgggcatcaccaggctgcttacaatgctctgcttaat
gctggggagtccagactgtctgagctcaatgttgaacgggcgaagtggctctggtccaag
ggtgatgtacatcaagctctcattgttctccagaagggagcagaactgttcctgtcaagt
accagcgctccaccagaacagcagcttatccacggcagagccatgctgctggtgggccgt
ttgatggaagagactgccaactttgaaagcaacgccgtgatgaagaaatataaagacgta
acagcactgttgcctgaatgggaagatggccatttttatcttgccaagtactatgacaaa
ctcatgccaatggttactgataacaagatggagaagcaaggagacttgatacgatatata
gtacttcactttggaaggtctttacagttcggaaaccaatatatttatcaatcgatgcca
cgtatgctttcactttggctggattttggagctaaagtttatgaatgggaaaaagctggt
cgtgctgacagattacaaatgaaaaatgaattgatgaaaataaataaggtcatatctgac
cataaaaaccagcttgctccttatcagttccttacagctttctcacagctaatctccaga
atatgtcactctcatgatgaggtgtttgctgtgttgatggaaattgtggctaaggtgttt
gtggcatacccccagcaggcaatgtggatgatgactgctgtgtctaagtcatcatatcca
atgcgtgtaaacagatgcaaagagatactcgagaaggccatacatacgaagccatcccta
ggaaaatttattggagatgcaactcgcctcactgataaactactagagctctgcaataag
ccggtggatggaaatactagcaccctcagtatgaatatccacttcaaaatgctgaagaaa
ctagtagaagaaacaacatttagtgaaatccttattcctctacagtccgtgatgattccc
accctaccgtctactgcagggaagcgtgaccatgctgatcatgatccattccctggccac
tgggcgtacctctcaggctttgatgacgcggtagagattctgccttctctccagaaacca
aagaaaatttctctaaagggatcagacggtaaatcatacattatgatgtgtaagccaaaa
gatgatcttagaaaggactgccggctgatggaatttaactctttaatcaacaagtgttta
cgcaaagatgcagaatcacgaaggagagagcttcatattcgaacctatgctgtcattcca
ctgaatgatgaatgtggaatcatagagtgggtgaataatactgcaggattccggaacata
ttgatcaagctgtacaaggaaaaaggcatttacatgggtggaaaggaactgcggcagtgt
atgcttcccaagagcgcaccactacaagaaaagctgaaagtctttaaggaggccctactg
cctcgtcaccccccattgttccatgaatggtttttaagaacatttcctgatcctacttct
tggtataacagcagatcagcctattgccgttccactgctgtgatgtctatggtaggttac
atactgggcctaggggaccgccatggagaaaacattctttttgactcgcttactggggaa
tgtgtccatgtggattttaactgcctcttcaacaagggtgaaacatttgaagttccagag
atcgtccccttccgactaacacataacatggtcaatggtatgggccccatggggacggag
ggactttttcgacgtgcatgtgaggtcatcatgaggttaatgagagaacagagggagtca
cttatgagtgtgctgaaaccctttttacatgatcctttggtggaatggagtaaaccagca
agagggagtagtaaaggtcaagtcaacgagacaggagaagtgatgaatgaaaaggccaaa
acacatgtgcttgacatagagcagaggctacaaggtgtgattaagaccaggaatcgtgta
aagggacttccgctgtccattgaaggacatgtccattacctgatccaagaagccacagat
gagaaccttctcagccagatgtacttggggtgggctccgtatatgtga

DBGET integrated database retrieval system