KEGG   Xenopus laevis (African clawed frog): 398466
Entry
398466            CDS       T01010                                 

Gene name
mdm4.S, mdm4, mdmx
Definition
(RefSeq) MDM4, p53 regulator S homeolog
  KO
K10127  protein Mdm4
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    398466 (mdm4.S)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:xla04121]
    398466 (mdm4.S)
Ubiquitin system [BR:xla04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    398466 (mdm4.S)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP RNA_pol_Rpb1_4
Other DBs
NCBI-GeneID: 398466
NCBI-ProteinID: NP_001082434
Xenbase: XB-GENE-6256316
UniProt: Q7ZYI3
LinkDB
Position
2S
AA seq 475 aa
MSTSTALHLMDEQDPAPTTIQNTEESLVRVQPALLKILQSAGAKGDMFTLKQVMHYLGQY
IMVKGLYDKQHQHIVHCGSDELGKLLGITTFSVKDPRPLYDMLKKNLLRISCTDAGHSPS
RNKSQASDSLELEKSFASKTEVTDVIKRNDCVSSDMCTSFDNSHLKGNESSDYTKQSLDF
IFEEWDEAGLPWWFLGNLRTNYNLQSIGSTDIPSNQDIDTATVSDTTDDMWFLNDSRTDR
INMEVKMESSDSLEEEVGECDSKKPAQMIELTLYEDDDDLDDTQSLSEDTDTEVTSEECW
QCTKCHKFNSPVKRYCYRCWALRKDWYLDFPRLIHSSSTPTLPGKVSSQMIVDGLDIPDC
RRTVSAPMVGVQVPECRSLVPFLEPLDLAANSKAFSESTDTLLTFKAAEASLLSSRPLLE
PCQLCQRRQRNGSVVHGRTAHLVTCFSCACNLKKNQKGCPVCEKPIQMVVKIYVA
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgtctacatcaactgctttgcatctgatggatgaacaggatcctgcaccaacgaccatt
caaaatacggaggaaagtctggttcgtgtacagccagctcttctgaaaatcctccaatca
gctggtgcaaagggagatatgtttacgttaaaacaggtcatgcattacctggggcagtat
atcatggtaaaaggattatatgacaaacagcaccagcatattgttcattgtggctctgat
gaacttggaaaattattaggtattactacattttctgtgaaagacccaaggccactatat
gacatgttaaagaagaaccttttaagaatttcttgcacagatgctggacacagtccctca
agaaacaaatcgcaggcttcggacagtttggagctggagaagagttttgctagtaaaact
gaagtcacagacgttatcaagagaaatgattgtgttagtagtgatatgtgtacctcattt
gacaacagtcatttaaaaggcaatgaaagttcagattatacaaagcaatcactggatttt
atatttgaggaatgggatgaagctggactgccttggtggttcctaggaaatttaaggaca
aattacaaccttcaaagcattggatccacagatattccctcaaatcaggatatagacaca
gctacagtgtctgacacaactgatgacatgtggttcttaaatgattctcgtactgatcgt
attaatatggaggtgaagatggagtcctcagactcacttgaggaagaagttggagaatgt
gatagcaaaaagcctgctcagatgattgaattgactctgtatgaagatgatgatgatctt
gacgacacacaaagtttgagtgaagatacagatacagaggtcacatcagaggaatgctgg
cagtgtacaaaatgccacaaatttaattcaccagtaaaacgttactgctaccgctgctgg
gcacttcgcaaagactggtatctggactttcctcgcctcattcactcttcttccactccc
acccttcctggtaaagttagttcccaaatgattgtggatggtttagacatccctgattgt
cgtagaacagtctctgctcccatggtgggggtccaagtacctgaatgtagatctctagtg
ccttttctggaacctttagatttggcagcaaattccaaagccttctctgagagcacagat
acactgcttacttttaaggctgcagaagcttcactgctttcaagccgccctctcttggag
ccgtgtcaattgtgccagaggcgacaacgcaatggcagtgtggtacatggacgaactgcc
cacctggtgacttgtttttcttgtgcttgcaatcttaaaaagaatcaaaaaggatgtcct
gtgtgcgagaagccaatacagatggtggtgaagatatatgttgcataa

DBGET integrated database retrieval system