KEGG   Xenopus laevis (African clawed frog): 399179Help
Entry
399179            CDS       T01010                                 

Gene name
park7.L, park7, park7a
Definition
(RefSeq) parkinson protein 7 L homeolog
  KO
K05687  protein DJ-1 [EC:3.5.1.124]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:xla01002]
    399179 (park7.L)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xla04147]
    399179 (park7.L)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.124  protein deglycase
     399179 (park7.L)
Peptidases [BR:xla01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   399179 (park7.L)
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   399179 (park7.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DJ-1_PfpI ThiJ_like GATase_3
Motif
Other DBs
NCBI-GeneID: 399179
NCBI-ProteinID: NP_001083896
Xenbase: XB-GENE-1005323
UniProt: Q6NTU4
LinkDB All DBs
Position
7L
AA seq 189 aa AA seqDB search
MAGKRALVILAKGAEEMETVIPTDVMRRAGIKVTVAGLSGKDPVQCSRDVMLCPDTSLEE
ARTQGPYDVVVLPGGNLGAQNLSESPVVKEVLKEQEAKKGLIAAICAGPTALTVHGVGIG
KTITTHPLAKDKIVNPDQYKYSEERVVKDENFITSRGPGTSFEFALEIVCTLLGKEVAEQ
VKTPLLLKD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcaagagggctctagtgattctggccaagggggccgaggagatggagacagtc
attcctactgatgtcatgagacgggctggaataaaggtaacggttgcaggtctaagcgga
aaggatcctgttcaatgcagcagagatgtgatgttgtgtcccgacactagtctggaggag
gcccgcacacaggggccatatgatgtggtggtacttccggggggcaatctgggtgctcag
aatttgtcagagtctcctgtagtgaaggaggtgttgaaggagcaggaagccaaaaaaggt
ttaattgcagctatatgtgcaggacccactgccctgactgtacacggtgtaggaattggg
aaaaccatcacaacacaccctctggcaaaagataaaattgtgaatccagatcaatataaa
tattcagaagagcgcgtggtcaaggacgaaaacttcatcacaagccggggccccgggacc
agctttgagtttgctctagagattgtgtgcaccctacttggaaaggaggtggcagagcaa
gtgaaaacaccacttcttctcaaagactag

DBGET integrated database retrieval system