KEGG   Xenopus laevis (African clawed frog): 399216Help
Entry
399216            CDS       T01010                                 

Gene name
sod2.L, sod2, sodMt
Definition
(RefSeq) superoxide dismutase 2, mitochondrial L homeolog
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    399216 (sod2.L)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    399216 (sod2.L)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     399216 (sod2.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 399216
NCBI-ProteinID: NP_001083968
Xenbase: XB-GENE-1000995
UniProt: Q6UTE6
LinkDB All DBs
AA seq 224 aa AA seqDB search
MLCRLSVCGRGRMRCVPALAYSFCKEKHTLPDLPYDYGALQPHISAEIMQLHHSKHHATY
VNNLNITEEKYAEALAKGDVTTQVSLQAALKFNGGGHINHTIFWTNLSPNGGGEPQGELL
DAIKRDFGSFEKFKEKLNTVSVGVQGSGWGWLGYNKDSNRLQLAACANQDPLQGTTGLIP
LLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYQASKK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgcaggctcagtgtttgtggcaggggaaggatgagatgcgttccagccttggcc
tactctttctgcaaggagaagcatactctgcctgacttgccttatgattatggtgctctg
cagccccacatcagtgctgaaattatgcagctacaccacagtaaacaccatgctacctat
gtaaacaacctaaatattactgaggaaaaatatgcagaggccctggctaaaggggatgtt
acaactcaagtctctcttcaagctgcacttaaatttaatggtggtggccatatcaatcac
acaatcttctggacaaacctttcccctaatggtggaggggagccacaaggagaacttcta
gatgccataaagcgagactttggctcctttgagaagtttaaggaaaaattaaatacggtg
tcagttggagtccagggatcagggtggggatggctgggttataacaaggactctaataga
cttcagctggctgcctgtgccaatcaagaccctctacaaggaacaacaggtcttatccct
ctgcttggaatcgatgtgtgggagcatgcttattacttgcaatataaaaatgtcagacca
gactatttgaaagcgatctggaatgttatcaactgggagaatgtcaccgaaagatatcag
gcttccaaaaaataa

DBGET integrated database retrieval system