KEGG   Xenopus laevis (African clawed frog): 399314
Entry
399314            CDS       T01010                                 

Gene name
cdk2.S, cdk2, eg1
Definition
(RefSeq) cyclin-dependent kinase 2 S homeolog
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04114  Oocyte meiosis
xla04115  p53 signaling pathway
xla04218  Cellular senescence
xla04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    399314 (cdk2.S)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    399314 (cdk2.S)
   04114 Oocyte meiosis
    399314 (cdk2.S)
   04115 p53 signaling pathway
    399314 (cdk2.S)
   04218 Cellular senescence
    399314 (cdk2.S)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    399314 (cdk2.S)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    399314 (cdk2.S)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:xla03032]
    399314 (cdk2.S)
   03036 Chromosome and associated proteins [BR:xla03036]
    399314 (cdk2.S)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     399314 (cdk2.S)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: CMGC group
  CDK family
   399314 (cdk2.S)
DNA replication proteins [BR:xla03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    399314 (cdk2.S)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    399314 (cdk2.S)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Haspin_kinase APH Kinase-like
Other DBs
NCBI-GeneID: 399314
NCBI-ProteinID: NP_001084120
Xenbase: XB-GENE-1001995
UniProt: P23437
LinkDB
Position
2S
AA seq 297 aa
MENFQKVEKIGEGTYGVVYKARNRETGEIVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLNQDLKKFMDRSNISGISLALVKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINSDGAIKLADFGLARAFGVPVRTFTHEVVTLWYRAPEILLGCKFY
STAVDIWSLGCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDEVSWPGVTTMPDYKSTF
PKWIRQDFSKVVPPLDEDGRDLLAQMLQYDSNKRISAKVALTHPFFRDVSRPTPHLI
NT seq 894 nt   +upstreamnt  +downstreamnt
atggagaatttccagaaggtggagaagatcggggagggcacgtacggggtggtgtacaag
gctcggaacagagagaccggggaaattgtggctctgaaaaagatacgcttggacactgag
acagaaggagttccaagcacagccatccgggaaatttccctcctcaaagaactgaaccat
cccaacattgtgaagcttcttgatgtcattcatacggaaaacaagctctaccttgtcttc
gagttccttaaccaagatctgaagaaattcatggaccggtcaaacatttctggaatttca
ttggccctagttaaaagctatctgttccagttgcttcaaggtttggctttctgccactca
catcgtgtcttacatcgtgatctaaaaccacagaacctgcttattaattctgatggagcc
atcaaacttgccgactttggactagctcgggcatttggtgtgcctgtgagaaccttcact
catgaggttgtcactctgtggtacagagcaccagaaatccttcttggctgcaagttctac
tccacggctgtagatatctggagcctgggatgtatttttgctgaaatgatcaccaggaga
gcgctttttccaggagattctgaaattgatcagctttttcgtatctttcgaacactgggg
acccctgatgaagtgtcctggccaggagtcacaactatgccagattacaagtcaaccttt
cccaagtggatccgacaagactttagcaaagtggtaccacctttggatgaggatggtaga
gatcttttagctcaaatgcttcagtatgactccaacaaacggatttctgctaaagtagcg
ctgacccatcctttcttccgagatgtgagcagacctactccacatctgatttag

KEGG   Xenopus laevis (African clawed frog): 432036
Entry
432036            CDS       T01010                                 

Gene name
cdk2.L, eg1
Definition
(RefSeq) cyclin-dependent kinase 2 L homeolog
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04114  Oocyte meiosis
xla04115  p53 signaling pathway
xla04218  Cellular senescence
xla04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    432036 (cdk2.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    432036 (cdk2.L)
   04114 Oocyte meiosis
    432036 (cdk2.L)
   04115 p53 signaling pathway
    432036 (cdk2.L)
   04218 Cellular senescence
    432036 (cdk2.L)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    432036 (cdk2.L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    432036 (cdk2.L)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:xla03032]
    432036 (cdk2.L)
   03036 Chromosome and associated proteins [BR:xla03036]
    432036 (cdk2.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     432036 (cdk2.L)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: CMGC group
  CDK family
   432036 (cdk2.L)
DNA replication proteins [BR:xla03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    432036 (cdk2.L)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    432036 (cdk2.L)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Haspin_kinase APH Kinase-like
Other DBs
NCBI-GeneID: 432036
NCBI-ProteinID: NP_001084976
Xenbase: XB-GENE-17345129
UniProt: Q6IRQ7
LinkDB
Position
2L
AA seq 297 aa
MENFQKVEKIGEGTYGVVYKARNRDTGEIVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLNQDLKKFMDASNISGISLALVKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINSDGAIKLADFGLARAFGVPVRTYTHEVVTLWYTAPEILLGCKFY
STAVDIWSLGCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDEVSWPGVTTMPDYKSTF
PKWIRQDFSKVVPPLDEDGRDLLAQMLQYDSNKRISAKAALTHPFFRDVSRPTPHLI
NT seq 894 nt   +upstreamnt  +downstreamnt
atggagaatttccagaaggtggagaagatcggggagggcacgtacggggtggtgtacaaa
gctcggaaccgagacaccggggagattgtggctctgaaaaagatacgcctggacactgag
acagaaggagttccaagcacagccatccgggaaatttccctcctcaaagaactgaatcat
cccaatattgtgaagcttcttgatgtcattcacacagaaaacaagctctaccttgtcttt
gagttccttaaccaagatctgaagaaattcatggatgcttcaaatatttctggaatttca
ctggccctagttaaaagctatctgttccagttgctccagggtttggctttctgccactcg
catcgtgtcttacatcgtgatcttaaaccacagaacctgcttattaattctgatggagcc
atcaagcttgctgactttggactagctcgggcatttggtgtgcctgtgagaacctatact
catgaggttgtcactctgtggtacacagcaccagaaatccttcttggctgcaagttctac
tccacggctgtagatatctggagcctgggatgtatttttgcagaaatgatcacgaggcga
gcgctttttccaggagattctgaaattgatcaactctttcgcatctttcgaaccctgggg
acccctgatgaagtgtcctggccaggagtaacaactatgcccgattacaaatcaaccttt
cccaagtggatcagacaagactttagcaaagtggtgccgcctttggatgaggatggtcga
gacctcttagctcaaatgcttcagtatgactccaacaaacgtatttctgctaaggcagcg
ctgacccatcctttcttccgagatgtgagcagaccaacaccacatctgatttag

DBGET integrated database retrieval system