KEGG   Xenopus laevis (African clawed frog): 404687
Entry
404687            CDS       T01010                                 

Gene name
tnfrsf10b.S, cd262, dr5, killer, tnfrsf10b, tnfrsf10b-a, tnfrsf10b-b, trailr2, trick2, trick2a, trick2b, trickb, xDR-M1, xDR-M2, ztnfr9
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 10b S homeolog
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04060  Cytokine-cytokine receptor interaction
xla04115  p53 signaling pathway
xla04210  Apoptosis
xla04217  Necroptosis
xla05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    404687 (tnfrsf10b.S)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    404687 (tnfrsf10b.S)
   04217 Necroptosis
    404687 (tnfrsf10b.S)
   04115 p53 signaling pathway
    404687 (tnfrsf10b.S)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    404687 (tnfrsf10b.S)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:xla04050]
    404687 (tnfrsf10b.S)
   04090 CD molecules [BR:xla04090]
    404687 (tnfrsf10b.S)
Cytokine receptors [BR:xla04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   404687 (tnfrsf10b.S)
CD molecules [BR:xla04090]
 Proteins
  404687 (tnfrsf10b.S)
SSDB
Motif
Pfam: TNFR_c6 Death Adeno_terminal
Other DBs
NCBI-GeneID: 404687
NCBI-ProteinID: NP_001084464
Xenbase: XB-GENE-6253239
UniProt: Q76B98
LinkDB
AA seq 328 aa
MAPRGETTGYAPMAKLTFGFFSFLLVVSTTNGLPLPPEMYYQAGNIRCLRCPAGTYVGMP
CTTQDTVGKCFPCHTGSSFSEGFTGLDHCLTCLSCRDDQEEVRPCTATQNAECRCKKGTY
CPLDHPCEVCLTCTESCPPGHELQFPCNSTSDSHCGPAQSGSWIIGVCVPILLILLLLIG
LCLCKHLKWCKDGRSRVQMSISLWTGNPDKVEIPLISPCLVFSAETKKEDQEAIFRRSWD
HFVDQVPTPKWDQFMRTLCLSPISVSEAKENNRDNSREQKIAMLQAWHQQKSGDVNKLLS
YLHSIQLHTPARTIVQKLLQEGHYVDKN
NT seq 987 nt   +upstreamnt  +downstreamnt
atggccccgcgaggggagaccactggatatgcccccatggccaaacttaccttcggcttc
ttctccttcttgttggtggtctccactaccaatgggctgccgttaccccccgagatgtat
taccaggctggaaatatccgatgtctgcgatgccctgcagggacgtatgtgggaatgcca
tgcacaacgcaggacactgtggggaaatgctttccctgccacacagggtcttcatttagt
gaaggtttcactggcctggaccactgtctcacctgtttgagttgtcgtgatgatcaggag
gaggtgagaccctgcacagccactcagaatgctgaatgccgttgcaagaaagggacgtac
tgccccttggatcacccgtgcgaagtgtgtctcacgtgtaccgaaagctgccccccaggc
cacgaactccagttcccgtgcaactccacttcggatagtcactgcggacctgctcaaagt
ggatcgtggataatcggggtgtgtgtcccaattctactcattctactgcttctgattgga
ttatgtctgtgtaaacatctaaagtggtgtaaagatgggcgctctcgagttcagatgtcc
atttctttatggactggaaacccggacaaagtagaaattccccttatatctccgtgtttg
gtcttctcagcagaaacaaagaaagaagatcaagaagcaatattccgccgatcttgggac
cactttgttgaccaggtgccaacgccaaaatgggaccaattcatgcgaacgttgtgcctc
tctcccatttctgtgagtgaagccaaggaaaacaacagagacaactccagagagcagaag
attgccatgctccaggcctggcaccagcagaaatccggagatgtcaataagctgctgtct
tatctgcactccattcaattgcacaccccagccagaaccatcgtccaaaaacttttacag
gaaggacactatgtagacaaaaattaa

KEGG   Xenopus laevis (African clawed frog): 404688
Entry
404688            CDS       T01010                                 

Gene name
tnfrsf10b.L, cd262, dr5, killer, tnfrsf10b, tnfrsf10b-a, tnfrsf10b-b, trailr2, trick2, trick2a, trick2b, trickb, xDR-M1, xDR-M2, ztnfr9
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 10b L homeolog
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04060  Cytokine-cytokine receptor interaction
xla04115  p53 signaling pathway
xla04210  Apoptosis
xla04217  Necroptosis
xla05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    404688 (tnfrsf10b.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    404688 (tnfrsf10b.L)
   04217 Necroptosis
    404688 (tnfrsf10b.L)
   04115 p53 signaling pathway
    404688 (tnfrsf10b.L)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    404688 (tnfrsf10b.L)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:xla04050]
    404688 (tnfrsf10b.L)
   04090 CD molecules [BR:xla04090]
    404688 (tnfrsf10b.L)
Cytokine receptors [BR:xla04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   404688 (tnfrsf10b.L)
CD molecules [BR:xla04090]
 Proteins
  404688 (tnfrsf10b.L)
SSDB
Motif
Pfam: TNFR_c6 Death Adeno_terminal
Other DBs
NCBI-GeneID: 404688
NCBI-ProteinID: NP_001084466
Xenbase: XB-GENE-6077834
UniProt: Q76B99
LinkDB
Position
3S
AA seq 328 aa
MAPRGERNGYAPMAKLTFAFLLVVSTSNGLPLNSDMYYQAGNIRCLRCPAGTYVEEPCTT
RDTKGECIPCHPGSTYSEGPTGLDHCLSCSRCRDDQEEVRSCTATQNAECRCKKGTYCPM
DHPCEVCLTCTESCPPGQELHLPCNSTSDSHCGPAESGSLKTWIWVPFVAFLLLLTGFFL
YKHLKWCEDLHNRVEMLNSLCVSKITGNLGREEIPLISPKLTFVNADHKEQEAIFRRSWD
HFFEHVPMERWDQFMRNLHISANTVYEAKENNRGNSREQKIAMLQAWYQQNSGDVNDLLA
TLHAIHLHTPARTIVRILLQERDYVEKN
NT seq 987 nt   +upstreamnt  +downstreamnt
atggccccgagaggggagcgcaatggatatgccccaatggcaaaacttaccttcgccttc
ttgttggtggtctccactagcaatgggcttccattaaactcagatatgtattaccaggct
ggaaatatccgatgtctgcgatgccccgcagggacgtatgtggaagagccatgcacaacg
agggacactaagggggaatgtattccctgccacccaggttccacttatagtgaaggtcca
actggcctggaccactgcctcagctgttctaggtgtcgggatgatcaggaggaggtgagg
tcctgcacagccactcagaatgcagaatgccgatgcaagaaaggtacctactgccccatg
gatcacccctgcgaagtgtgtctcacctgtaccgaaagctgccctccaggccaggaactc
cacctcccgtgcaactcaacatcagatagtcactgcggacctgctgaaagtggatcatta
aaaacctggatttgggtcccatttgtagcctttctactgttgctgactggattctttttg
tataaacatctaaagtggtgtgaagatttgcacaatcgagttgagatgctcaactcttta
tgtgtctccaagataactggaaacctgggaagagaagagattcccctgatctctccaaag
ttgactttcgtaaatgcagatcacaaagagcaagaagcaatattccgccgatcttgggac
cacttttttgaacatgtgccaatggaaagatgggaccaattcatgcgaaacctgcacatc
tctgccaacactgtgtatgaagccaaggagaacaacaggggcaactccagagagcagaag
attgccatgctacaggcctggtaccagcagaattccggagatgtgaatgatctgctggcc
actctgcacgccattcatttgcacacccctgccagaacaattgtcaggatacttttacaa
gaaagagactatgtagagaaaaattaa

DBGET integrated database retrieval system