KEGG   Xenopus laevis (African clawed frog): 431912Help
Entry
431912            CDS       T01010                                 

Gene name
gys2.L, gys2
Definition
(RefSeq) glycogen synthase 2 L homeolog
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00500  Starch and sucrose metabolism
xla01100  Metabolic pathways
xla04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    431912 (gys2.L)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    431912 (gys2.L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:xla01003]
    431912 (gys2.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     431912 (gys2.L)
Glycosyltransferases [BR:xla01003]
 Polysaccharide
  Storage polysaccharide
   431912 (gys2.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 431912
NCBI-ProteinID: NP_001084863
Xenbase: XB-GENE-6251565
UniProt: Q6NRR2
LinkDB All DBs
Position
Un
AA seq 702 aa AA seqDB search
MPLSRSLSVSSLNGLPLWQDEDLPLQDLLLFEVAWEVTNKVGGIYTVIQTKAKVTADEWG
DNYFLMGPYMEHNVRTQVEICDPPNGHIRKAIDVLQSQGCQVYFGRWLIEGNPYVVLFDI
GSAAWNLDRWKGEFWDCCTVGIPYNDREANDALIFGSLTAWFLKELTDQFQDKPGVIAHF
HEWQAGAGLVLCRNQKLPVATIFTTHATLLGRYLCAANVDFYNQLDQFDIDREAGDREIY
HRYCMERAAVHCAHVFTTVSQITGIEAEHMLKRKPDVITPNGLNIKKFSATHEFQNLHAM
YKAQIQEFVRGHFYGHLDFSLEKTLFFFIAGRYEYTNKGADIFLEALSRLNFLLRVHRSD
VTVVVFFIMPTKTNNFNVETLKGQAVRKQLWDTAHSVKEKFGKKLYEALLKGEIPDLNKI
LDRDDVTIMKRAIFATQRQSLPPITTHNMVDDSTDPILNTVRRIGLFNSRTDRVKIIVHP
EFLSSTSPLLPLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQ
EHVADPTAYGVYITDRRFRSPDESCNQLTQLLYGFCQQSRRQRIIQRNRTERLSDLLDWR
YLGRFYKHARHLALCRMFPDKFQMEPSAPPKTEGFRYPRPSSVPPSPAVSQPSSPHDSEE
EDDEERYDEDEEAERDRQNIKSTFSFGPVSRGKKKKHGENRN
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgagccgctccctatctgtctcctctctcaatggcctccccctgtggcaggat
gaagatttgcccctacaggacctgctgctcttcgaggtggcctgggaggtcactaacaaa
gtggggggaatttacaccgttatccagaccaaagccaaggtgacggcggatgagtggggg
gacaattacttcctgatggggccctacatggagcacaacgtcaggactcaggtggagatt
tgtgacccccccaacggccacatccgaaaagccatcgatgtcctgcagtcccaggggtgt
caggtgtatttcgggaggtggctgattgaaggaaacccatatgtggttctgtttgacatt
gggtcggcggcctggaatttggacaggtggaaaggggaattctgggactgctgcaccgtg
gggattccctacaatgaccgggaagccaatgacgccctcatatttggatctctcaccgcc
tggttcctaaaagagctgacagaccagtttcaagacaaacccggtgtcattgcccatttc
catgagtggcaagcgggggctgggctagttctctgccgaaaccagaagcttccagtggcc
actatattcaccacccatgccaccctgctgggccgctacctctgcgctgctaatgtcgat
ttctacaatcaactggaccagtttgatatagaccgggaggcgggggatcgagagatctat
cacagatattgcatggaaagggcggcagttcattgtgcccacgtattcactactgtatca
cagatcacgggcatcgaggcagagcacatgctgaaacgaaaaccagacgtcattaccccc
aacggcttaaatattaaaaaattctcagcgacgcacgaatttcagaatctgcacgccatg
tacaaagcccaaatccaggagtttgtccgaggccacttctatgggcacctggacttcagt
ctggaaaagacgcttttctttttcatcgccgggcgctacgagtatacgaacaagggggca
gacatattcctggaggcgctgtcccgcctcaacttcctactcagggtgcacagaagtgat
gtcacagtggtggtgtttttcatcatgccgaccaagacaaacaacttcaatgtggagacg
ttaaagggacaggcggtcagaaagcaactctgggatacggcccattcggtgaaagagaag
tttgggaagaagttgtacgaggcgctactcaaaggagaaatcccagatctaaataagatt
ctggatcgagatgatgtgaccattatgaaaagagccatttttgctactcagcgccagtct
ctgcccccaatcacaacccacaatatggtcgatgactccacagaccccatactcaatact
gtcaggcgcatcggactcttcaacagcagaaccgacagagtaaagatcatcgtccatcca
gaattcctctcctccacaagtccccttttgcccctggactatgaagagtttgtacgaggt
tgccacttaggggtattcccttcatattacgagccttggggatatactccagccgaatgc
accgtgatgggaatcccaagcgtcaccaccaacctctccggctttggctgcttcatgcag
gaacacgtggcagatcccactgcctatggagtttacatcacggacaggcggttccgttcc
ccagatgaatcctgtaaccaactgacccagctcctgtacggattctgccagcagtctcgg
cgccagaggatcatccagaggaaccggacagaacgactttcagatctgctggactggaga
tacctggggcggttctacaaacacgcccgacacttggctctgtgccgcatgtttcctgac
aagttccagatggagcccagcgcccccccaaagactgaggggttccgctaccccagacct
tcctctgtgcccccttctcctgctgtctctcagccctccagtccccatgacagtgaagag
gaagatgatgaagaaaggtacgatgaagatgaagaagcagaaagagatcggcagaacatc
aaatcaaccttttcttttggtcctgtgtcccgggggaagaagaagaaacacggggagaac
agaaactga

DBGET integrated database retrieval system