KEGG   Xenopus laevis (African clawed frog): 432226
Entry
432226            CDS       T01010                                 

Definition
(RefSeq) uncharacterized protein MGC79057
  KO
K06509  CD82 antigen
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    432226
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xla04147]
    432226
   04090 CD molecules [BR:xla04090]
    432226
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   432226
  Exosomal proteins of other body fluids (saliva and urine)
   432226
  Exosomal proteins of colorectal cancer cells
   432226
CD molecules [BR:xla04090]
 Proteins
  432226
SSDB
Motif
Pfam: Tetraspanin DUF3827 DUF1310
Other DBs
NCBI-GeneID: 432226
NCBI-ProteinID: NP_001085147
UniProt: Q6IP10
LinkDB
Position
4L
AA seq 255 aa
MATSGCMKVTKYFLFLFNLLFFILGAVILGFGIWILVDKTSFISILQTSSWYLRTGSYIL
IAVGGLTMVMGFLGCLGAVNEIRCLLGLYFTFVLIILIAQVAAGILIYLQRDALKSEMSS
IIHKLIVTYDYEDGKNTSSETTWDYIQRNLQCCGWTSYHNWTENALLKNSTNEYPCSCMT
NQTSSNGFCEYKGSLDSAVYKAGCIQGVESWLQDNLGIILGVCVGVAVIELLGLILSMCL
CRSIQSEDYTKVPKY
NT seq 768 nt   +upstreamnt  +downstreamnt
atggcgaccagcggctgcatgaaagtcaccaagtacttcctgttcctgttcaacctcctg
ttctttattcttggtgccgtgatccttggatttggaatatggatcctcgtggacaaaacc
agctttatttcaatcctgcagacctcctcttggtacctgagaacaggctcctacattctc
atcgctgttgggggtttaacaatggtgatgggattcctgggctgcttgggagcagtgaat
gagatccgctgcctgttgggcctgtatttcaccttcgtgctcattatcctgatcgctcaa
gttgcagccggaattctgatttacctacagcgagatgcactaaagtccgagatgtcctcc
atcatccataaactgattgtcacatatgactatgaagatggaaagaacacgagctccgag
accacctgggattatatccagagaaatctccagtgctgcggttggaccagctatcataac
tggactgagaacgccctgcttaaaaactccaccaatgagtatccttgttcctgtatgacc
aaccagacttcttccaatggcttctgcgagtacaaaggttccttggactcggccgtgtac
aaagcgggctgcattcagggagtggagagttggctgcaggataatcttggcatcattctg
ggagtctgcgttggagtcgcagtcattgagctcctgggtctcatcctttccatgtgcctg
tgccgcagcattcaaagcgaagactacaccaaggtccccaaatactga

KEGG   Xenopus laevis (African clawed frog): 444244
Entry
444244            CDS       T01010                                 

Gene name
cd82.S, cd82
Definition
(RefSeq) CD82 molecule S homeolog
  KO
K06509  CD82 antigen
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    444244 (cd82.S)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xla04147]
    444244 (cd82.S)
   04090 CD molecules [BR:xla04090]
    444244 (cd82.S)
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   444244 (cd82.S)
  Exosomal proteins of other body fluids (saliva and urine)
   444244 (cd82.S)
  Exosomal proteins of colorectal cancer cells
   444244 (cd82.S)
CD molecules [BR:xla04090]
 Proteins
  444244 (cd82.S)
SSDB
Motif
Pfam: Tetraspanin DUF3827 DUF1310
Other DBs
NCBI-GeneID: 444244
NCBI-ProteinID: NP_001085817
Xenbase: XB-GENE-945248
UniProt: Q6GNW4
LinkDB
Position
4S
AA seq 255 aa
MATSGCMKVTKYFLFLFNLLFFILGAVILGFGIWILVDKTSFISVLQTSSWYLRTGSYIL
IAVGGCTMVMGFLGCLGAVNEIRCLLGLYFTFLLIILIAQVAAGILIYLQRDTLKTEMSS
IIHDLIVTYDYEDGKNTSCETTWDYIQRSLQCCGWTSYQNWTENALIKNSTNEYPCSCMT
NQTSSNGFCEYKGSLESAVYKAGCMQGVESWLQDNLGIILGVCVGVAVIELLGLILSMCL
CRNIQSEDYTKVPKY
NT seq 768 nt   +upstreamnt  +downstreamnt
atggcgaccagcggctgcatgaaagtcaccaagtacttcctgttcctgttcaacctcctc
ttctttattcttggtgcagtgatccttggatttggaatatggatcctcgtggacaaaacc
agctttatatcggtcctgcagacctcctcttggtacctgagaacaggctcctacattctc
atcgccgttgggggttgcacaatggtgatgggattcctgggctgcttgggagcagtgaat
gagatccgctgcctattgggcctgtatttcaccttccttctgattatcctgatcgctcaa
gttgcagccggaattctgatttacctacagcgagatacgctaaagaccgagatgtcctcc
atcatccatgatctgattgtcacatatgactatgaagatggaaagaacacaagttgcgag
accacctgggattatatccagagaagtctccaatgctgcggttggaccagctatcagaat
tggactgagaacgcactgattaaaaactccaccaatgagtatccttgctcttgtatgaca
aaccagacttcttccaatggcttctgtgagtacaaaggttccttggagtcggccgtgtac
aaagcgggctgcatgcagggagtagagagctggctgcaggataaccttggcatcattctg
ggagtctgcgtgggagttgcagtcatcgagctcctgggtctcatcctttccatgtgcctg
tgccgcaacattcaaagcgaagactacaccaaagtccccaaatactga

DBGET integrated database retrieval system