KEGG   Xenopus laevis (African clawed frog): 444261
Entry
444261            CDS       T01010                                 

Gene name
apaf1.L, apaf-1, apaf1
Definition
(RefSeq) apoptotic peptidase activating factor 1 L homeolog
  KO
K02084  apoptotic protease-activating factor
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
xla04210  Apoptosis
xla05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    444261 (apaf1.L)
   04115 p53 signaling pathway
    444261 (apaf1.L)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    444261 (apaf1.L)
SSDB
Motif
Pfam: WD40 NB-ARC APAF1_C ANAPC4_WD40 CARD WD40_like Ge1_WD40 BBS2_Mid CARD_2 AAA_16 AAA_22
Other DBs
NCBI-GeneID: 444261
NCBI-ProteinID: NP_001085834
Xenbase: XB-GENE-988971
UniProt: Q6GNU6
LinkDB
Position
3L
AA seq 1248 aa
MDEKARSLLLQNRTALVRDIRTAYIMDHMISDQVITPEEEARVKAQHTQVDKANFLINLI
LGKGKQAYVSFYNALLHEGYKDLALLLKEAANAEHSDSTKSSSNGITSYVQTVLCEGAVP
QRPVVFVTRPKLVTKIQQSLYKLNVESGWVTVYGMAGCGKSVLAAEVLRDHKILTECFPG
GVHWVSVGKQDKSGLLMKLQNLCTRLDQEAKYSQRPPLNAEEARERLRLMVNRMYPRCLI
VLDDVWDSWVLKAFDIQCRVLITSRDKSVTDSLSGFKEAVRVDSELEHSKGLEILSRFLS
LKAEELPSQAHSIIKVSKGSPLVVSLIGALLREFPTRWDFYLTQLKRKQFKRIRKSSSYD
YEALDEAMSISVDNLKEDFREYYNDFSIIEKDVKLPTQVLCILWDMEREDVEDMMQEFVN
KSLIYCDRNGKSFSYYLHDLQLDYLTERNRDRLTVLHAKLVDQYKKHYSSKLPTVEQEDC
VYWYHYLAYHMAKANLHQDLCSLLFSLNWLKAKSELFGTSHLIHEFVQYRNILDNQNAKA
REHFQEFIAVNGHLLGLNPDISIVQLGLGQAEDSEVYKQAILQAKEELKSGVLYVNWINK
QRMKNLPTLVVRPHKDAVFHACFSPDGRKFASCGADKTLQVFRSETGEKLLELEAHDDEV
LCCAFSADEKLLATCSADRKVKIWNAKTGKPIRVYEEHTEQVNCCQFTNGLSAPLLATCS
NDCFIMLWDSETEYSRNTLIGHTGAVYHCRYSPDDRYLASSSMDGSLKIWDVESANEEKS
IEVAKLFENEDESQPEVLLKCCAWSNDGSRIMVTTRNFLCIFDSTSCDLLSQLKACHQIL
YCDFCTTNQIVALALSHYVVQLWDIDSSTKIADFNAHLSWVHCVKFSPKSSSFLTSSDDQ
TVKLWETSNVSKPSATNLKREFDVSFNGEETLVLATSKDDCILLINGMTGETLSQINTQD
KCVTCCCLTNDYQLAAIGDRDGKVKVIDVSRGEILCKLDGHSATVQHCQFTADGKHLVSS
SDDSTIRVWSLASGESLELRGHKEPVKFFKILQESQVFSWSFDGTVKVWDLITGKLRKEF
ICHSETVLSCDISPDSTKFSTASADKSAKIWSLDMSTLLHELNGHQSCVRCCRFSWDNKY
LATGDDNGKIMIWSVQNGELLKQCCDISVNNENSLHDGWVTDLHFSPNSKLIVSSGANVK
WWDVDTGACKQTFYTVGTNLKSIHLCPTFRTFVTIDNLGILYVLKLIE
NT seq 3747 nt   +upstreamnt  +downstreamnt
atggatgagaaggctcgaagtctgttgcttcagaatcgaacagcgctggtgagggacatt
cgcacagcttacatcatggaccatatgataagtgatcaggtcattaccccagaggaggaa
gctcgagtaaaagctcagcacactcaggtggacaaagcaaatttcctcatcaatttaatt
cttggaaaaggcaagcaggcatatgtttctttttataatgctctgcttcacgaggggtac
aaagaccttgctcttcttcttaaagaggctgctaatgctgagcattctgacagtaccaag
agctcaagcaatggaattacttcatatgttcaaaccgtactctgtgagggagctgtacct
cagagaccagttgtgttcgtcacacggccgaagcttgtcactaagatacaacagagcctg
tacaagttgaatgtggaatctggctgggtaaccgtgtacgggatggctggctgcggaaag
tctgtcttggctgcagaagtacttcgagaccacaaaatactaactgaatgttttcctgga
ggagttcactgggtctctgttggaaagcaagacaaatccggactccttatgaaactacaa
aatttgtgcacccgcctagatcaggaggccaagtattcacagagacctccattaaatgct
gaagaagccagggaaagactgaggttgatggtgaatcgaatgtaccctaggtgcctcata
gttttggatgatgtttgggattcctgggtactcaaagcttttgatattcagtgtcgagtg
ctcattaccagcagagacaagagtgtgactgattcactttctggttttaaagaggctgtc
cgtgtagacagtgagcttgagcattcaaaaggccttgaaatcctctcacgctttctgagt
ttaaaagcagaagaactgccatcccaggcccatagcataattaaagtatccaaaggttct
cctcttgtagtatctctgataggagctctgctacgagaatttcccacccgttgggatttc
tacctcactcagctgaagagaaagcaatttaaaagaatacgaaagtcttcctcctatgat
tatgaggctcttgacgaagcaatgtcaataagtgtggataatctaaaagaagactttaga
gagtactacaatgatttctccattatagaaaaggacgtgaaattgcccacacaggtttta
tgtatcctatgggacatggaacgtgaggatgtggaagacatgatgcaggagtttgtcaac
aagtccttaatatactgtgatcgtaatggaaagtccttttcatattatttacatgatctc
caactggattatctcacagagaggaaccgggacagactgaccgttcttcacgccaaactt
gttgaccaatataaaaaacattattcaagtaaattacctactgtggagcaagaggattgt
gtgtattggtatcattacctagcctaccacatggccaaggccaatttacaccaagatctt
tgctcactcttgttttccctgaactggttaaaagctaaatcagaattgtttgggacatcc
cacctcattcatgaatttgtacagtatcgaaatattctggataatcagaatgcaaaagca
cgagaacattttcaagaattcattgctgtgaatggtcatcttcttggattgaatcctgac
attagtattgtgcagctgggccttggtcaggctgaagactctgaagtctacaaacaagct
attttgcaagccaaagaagagctcaaatctggagtgctctatgtcaactggataaacaag
caaaggatgaagaatctgccaacattggtggttcgtccacataaagatgctgttttccat
gcctgcttttctcctgatggacgaaaatttgcttcttgtggagctgataaaactttacag
gtcttcagaagtgaaacaggagagaaactccttgaattagaagcacatgatgatgaagtg
ctgtgttgtgcattttctgctgatgaaaagcttctagccacctgttctgcagacaggaaa
gtgaagatttggaatgccaagacgggaaaaccaataagggtgtatgaggagcatacagaa
caagtcaactgctgccagttcaccaatggactttcagcaccactgcttgccacatgctcc
aatgactgcttcatcatgctgtgggactctgagacggaatatagccgtaacactcttatt
ggacacacaggcgcagtctaccattgcagatattcacctgatgatcgatatctagccagt
tcctctatggatggttcattaaagatttgggatgtggagtctgcaaatgaggagaaatca
attgaagttgctaagctttttgaaaatgaagatgagtcacagcctgaagtgctgcttaaa
tgttgcgcttggtcaaatgatggttcaagaattatggtaaccactcgcaatttcctttgt
atttttgattctacgagctgtgaccttttgtctcaactcaaggcctgtcatcagatcctt
tactgtgacttctgcactactaatcagattgtagcgcttgctttgtcacactatgttgtt
cagctgtgggacatagattcgtctacaaagatagctgacttcaatgcacacctgagctgg
gttcactgtgtgaaattttctccaaaaagttcttcattcctgacatcttctgatgaccag
actgtgaagctttgggagactagtaatgtgagcaaaccatcagccactaacttaaagcgt
gagtttgatgtgtccttcaatggcgaggaaacactggttcttgcaactagtaaagatgat
tgtatactgctaattaatggaatgactggagagactttatcacagatcaacacacaggac
aaatgtgttacgtgctgctgtctcacaaacgactaccaactagcagctatcggggataga
gatggtaaagtaaaggttatagatgtatccaggggtgaaatcctctgtaaactggatggt
cacagtgctacagtccagcactgccagttcactgcagatggaaaacaccttgtttcaagc
tctgatgattccactattagagtctggagcttggcatctggagagagtttggaattacgt
gggcacaaagaacctgtgaaatttttcaagattttgcaagagtcacaagttttttcttgg
tcctttgatggaacagtcaaggtatgggacctcatcactggaaagctcagaaaagagttt
atttgccattctgagacagttctatcttgtgatatttcacctgactccaccaaattttca
actgcctctgctgataaaagtgccaagatatggagcttagatatgtctaccctcctccat
gaattgaatggacaccaaagctgtgtacgatgctgtcggttttcatgggacaacaagtat
ttggcaactggtgatgacaacggtaaaattatgatttggagtgtgcagaatggagagctg
ctgaaacagtgttgtgacatatctgtcaataatgaaaatagtctgcatgatggttgggtg
acagatctacacttctctcccaacagcaagctaattgtatcctctggggcaaatgtcaag
tggtgggatgtggatactggagcctgcaaacagacattctacacagttggcacaaatctc
aaatcaatccacttatgtcctacttttagaacctttgtaacaattgacaatctgggaatt
ctgtacgtgctgaagctaatagagtga

DBGET integrated database retrieval system