KEGG   Xenopus laevis (African clawed frog): 444407
Entry
444407            CDS       T01010                                 

Gene name
rassf1.S
Definition
(RefSeq) Ras association (RalGDS/AF-6) domain family member 1 S homeolog
  KO
K09850  Ras association domain-containing protein 1
Organism
xla  Xenopus laevis (African clawed frog)
SSDB
Motif
Pfam: Nore1-SARAH RA
Other DBs
NCBI-GeneID: 444407
NCBI-ProteinID: NP_001085978
Xenbase: XB-GENE-17336169
UniProt: Q6GN78
LinkDB
Position
4S
AA seq 273 aa
MGKGDKETPAFEMTWDSTSSSGYCSQEESDPELELFYTARTSLFPRRTSARPLDEKPEKK
PQALSKAETDQKIKDYNAQIKSNLFMSLNKDGSFTGFIKVQLKLVRPVSVAASKKPSCLQ
DRKGSGRSQPVKRRTSFYLPKDASKHLHLSSKTPASEVIQALLKKFTVLDNPRKFALFER
TEKGGQVSLRKLTDDEEPLKLRLLSGPCEKTLSFVLKENETGEVNWDAFSMPELQNFLRI
LQREEEEHMRQIIQRYTRCREKMQEALASRSPG
NT seq 822 nt   +upstreamnt  +downstreamnt
atggggaagggagataaagaaacaccagctttcgaaatgacttgggacagcacctccagc
agtggctactgtagccaagaggagtccgaccccgagctggagcttttctacactgcaaga
acctcgctcttcccacggagaacgtctgctcggcccctggatgaaaagccagaaaagaag
ccgcaggccctgagcaaggcagagacagatcagaaaataaaagattataatgctcagata
aagagcaatctcttcatgagcctgaataaggatggctcattcactggattcatcaaagtt
cagctgaaacttgtcagaccggtttctgtcgcagcttccaaaaagccttcctgtttacag
gatcggaaaggtagtggacgctcccagccagtcaaacgtaggacctccttctacctcccc
aaagatgcttcaaagcacctgcatctgagttcaaagaccccagctagtgaggtcattcag
gcgctgctgaagaagttcactgtgcttgataaccccaggaagtttgctttgtttgaaagg
acagaaaagggtggacaagtgtccttaaggaagttaactgacgacgaggagcctctgaag
ctgcgtcttctctcaggaccatgcgagaaaactctgagttttgtgcttaaggagaacgag
acaggagaagtcaattgggatgcattcagcatgccggagctgcagaatttcttgcgcatt
ctgcagcgtgaggaagaagagcacatgcgacagataattcagcggtacacacgttgccgg
gagaagatgcaggaggcgctagcatcacgctcacctggctga

DBGET integrated database retrieval system