KEGG   Xenopus laevis (African clawed frog): 444660
Entry
444660            CDS       T01010                                 

Gene name
perp.S, kcp1, krtcap1, perp, pigpc1, thw
Definition
(RefSeq) PERP, TP53 apoptosis effector S homeolog
  KO
K10136  TP53 apoptosis effector
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    444660 (perp.S)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_3 L_HMGIC_fpl Claudin_2 DUF2700 DUF973 YwcE Clc-like
Other DBs
NCBI-GeneID: 444660
NCBI-ProteinID: NP_001086231
Xenbase: XB-GENE-6254601
UniProt: Q6GLU5
LinkDB
Position
5S
AA seq 182 aa
MFKCGIAYPRCKWILPLLMLFAIIFDIIALSGRGWVETESGREYASLWEKCSGNGGSCLS
IMDFAWGKATAALLIIGFILLIICFILSFVALCVPNMGLMRIIGAVLILAVILQVIALII
YPVSFTNQLANGNESYLYSWTYGFGWGSTIIMFGCAIFFCCLPNYEDELLGNVKTKYFYT
SA
NT seq 549 nt   +upstreamnt  +downstreamnt
atgtttaagtgcggtattgcttatcccagatgcaaatggatcctacctctacttatgctc
tttgcaattatatttgatatcatcgccctgtctggcaggggctgggtggagacagaaagc
ggcagggaatatgcatcgttgtgggaaaaatgcagtgggaacggcggcagctgcctatct
atcatggatttcgcttggggtaaagcaactgcggcacttctgatcattggcttcatcttg
ctgatcatttgtttcattctatcctttgttgctctatgtgtgccaaatatgggtttgatg
agaataattggagccgttctcattttagcagttattttgcaggtgattgcactgattatt
tatccagtgagttttaccaaccaattggctaatggtaatgagagttatctgtacagctgg
acatatggcttcggttggggtagcacaattatcatgtttggctgtgccatattcttctgc
tgtctccccaactatgaagatgaactcctggggaacgtcaagacaaaatacttctatact
tctgcgtaa

DBGET integrated database retrieval system