KEGG   Xenopus laevis (African clawed frog): 444686
Entry
444686            CDS       T01010                                 

Gene name
fgf1.L, fgf1
Definition
(RefSeq) fibroblast growth factor 1 (acidic) L homeolog
  KO
K18496  fibroblast growth factor 1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    444686 (fgf1.L)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    444686 (fgf1.L)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:xla04052]
    444686 (fgf1.L)
   00536 Glycosaminoglycan binding proteins [BR:xla00536]
    444686 (fgf1.L)
Cytokines and growth factors [BR:xla04052]
 Growth factors
  Growth factors (RTK binding)
   444686 (fgf1.L)
Glycosaminoglycan binding proteins [BR:xla00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   444686 (fgf1.L)
SSDB
Motif
Pfam: FGF Fascin DFF40
Other DBs
NCBI-GeneID: 444686
NCBI-ProteinID: NP_001086257
Xenbase: XB-GENE-865566
UniProt: Q6GLR6 A0A1L8GXF9
LinkDB
Position
3L
AA seq 155 aa
MAEGDITTFNAITESFSLPIGNYKKPKLLYCNNGGYFLRILPEGVVDGTRDRNDLYITLK
LSALSQGEVHIKTTETGCYLAMDSSGQLYGTLTPNEECLFLETLEENHYNTYKSKKYADM
NWFVGIKKNGASKKGSRTHYGQKAILFLPLPASPD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggcagagggagacatcacaacattcaatgccattacagagtctttcagtcttccaatt
ggcaactacaagaaaccaaagcttctgtactgtaataacggagggtattttttgcgtatc
cttccagaaggggttgtggatggaacaagagacagaaatgacctttacattacactgaaa
ttaagtgcactaagtcaaggtgaggtccatatcaagaccacagagacagggtgttattta
gccatggactccagtggacagttatatggaactctgacgccaaatgaagaatgcctgttt
ctggagacattagaagagaatcattataacacatacaagtcaaagaagtacgcagacatg
aactggtttgtggggataaagaagaacggggcaagcaaaaaggggtcaaggactcactat
ggacaaaaagccatccttttcctacctctgccagcatcacctgactag

DBGET integrated database retrieval system