KEGG   Xenopus laevis (African clawed frog): 446857Help
Entry
446857            CDS       T01010                                 

Gene name
aldh2.L, aldh2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial) L homeolog
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00010  Glycolysis / Gluconeogenesis
xla00053  Ascorbate and aldarate metabolism
xla00071  Fatty acid degradation
xla00280  Valine, leucine and isoleucine degradation
xla00310  Lysine degradation
xla00330  Arginine and proline metabolism
xla00340  Histidine metabolism
xla00380  Tryptophan metabolism
xla00410  beta-Alanine metabolism
xla00561  Glycerolipid metabolism
xla00620  Pyruvate metabolism
xla01100  Metabolic pathways
Module
xla_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    446857 (aldh2.L)
   00053 Ascorbate and aldarate metabolism
    446857 (aldh2.L)
   00620 Pyruvate metabolism
    446857 (aldh2.L)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    446857 (aldh2.L)
   00561 Glycerolipid metabolism
    446857 (aldh2.L)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    446857 (aldh2.L)
   00310 Lysine degradation
    446857 (aldh2.L)
   00330 Arginine and proline metabolism
    446857 (aldh2.L)
   00340 Histidine metabolism
    446857 (aldh2.L)
   00380 Tryptophan metabolism
    446857 (aldh2.L)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    446857 (aldh2.L)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     446857 (aldh2.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 446857
NCBI-ProteinID: NP_001087022
Xenbase: XB-GENE-866006
UniProt: Q6DCT5
LinkDB All DBs
Position
1L
AA seq 521 aa AA seqDB search
MLRSVLGSLYGKVSRVPLGLQLCRYSVAIPTPNPKPDVHFNQLFINNEWHDAVSKKTFPT
INPSTAEVICHIAEGDKADVDKAVKAAREAFRLGSPWRRMDASQRGVLINRLADLIERDR
AILATLETLDNGKPYAISYAVDLDLVLKCLRYYAGWADKCHGKTIPIDGDYFTYTRHEPV
GVCGQIIPWNFPLLMLAWKFGPALATGNVIVMKVAEQTPLSALHVASLVKEAGFPPGVVN
IITGMGPTAGSAISSHMDVDKVAFTGSTEVGRLIQQAAGKSNLKKVTLELGGKSPIIIFS
DADLDWAVEQAHFALFFNQGQCCCAGSRTYVQEDIYNEFVERSIQRAKNRIVGNPFDFKT
EQGPQVDEEQFNKILGYIKSGKKEGAKLLYGGNPAADRGYFIQPTVFGDVTDNMTIAREE
IFGPVMQILKFKSIEEVIDRANNSMYGLAAAVFTKDIDKAHTFSQSVRAGTVWINCYDVF
GAQAPFGGYKASGIGRELGEYGLEAYTEVKNVTIKIPQKNS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctccggtcagtcttggggagcctctacggcaaggtgtctcgtgtacctctggggcta
cagctctgcagatattccgttgccataccaacccccaaccctaagccagatgtgcacttc
aaccagctctttatcaacaatgagtggcatgatgctgtcagcaagaagaccttccccacc
atcaacccatctacagcagaagtgatatgccatattgcagaaggagacaaagctgatgtg
gacaaagcagttaaagctgcacgcgaggcattcagattgggatcaccatggaggagaatg
gatgcatctcaaaggggtgttctgataaaccgtctggcagatcttattgaaagagacaga
gctatattggcaaccttggagactttagacaatggaaagccatatgcaatttcctatgca
gtggacttggatcttgtactaaaatgcctaagatattatgcaggctgggctgacaaatgt
catggaaagacgatcccaatcgatggagattattttacctacaccagacatgaacctgtc
ggagtgtgtggacagatcattccgtggaattttcctcttctaatgcttgcttggaaattt
ggacctgctctggccactggaaatgtgattgtcatgaaggtggctgagcagacccctctc
tctgctctgcatgttgctagccttgtgaaagaggctggattccctccgggtgttgtaaat
atcattactggaatgggtcccacagctggttcagctatctcttctcatatggatgtggat
aaagtggcatttactggttctacagaggttggtcgtttaatccaacaagcagctgggaaa
agcaatttaaaaaaagtgacactggaacttggtgggaagagcccaataattatcttttct
gatgcagatttggattgggctgtggagcaggcccactttgcccttttctttaaccagggc
cagtgctgctgtgctggctctcgcacttatgttcaggaagatatctacaatgagtttgtt
gagaggagcatacaaagagcaaagaataggattgttgggaacccctttgacttcaaaaca
gagcaaggacctcaggtggatgaggaacagtttaataaaattctggggtatataaaatct
gggaaaaaggaaggtgcaaagcttctctatggtggtaatcctgctgctgatcgaggctat
tttatccagcccaccgtttttggagatgtgactgacaacatgaccattgctagagaagag
atttttggacctgtgatgcaaattctaaagtttaaatcaattgaagaggtgatcgaccga
gccaacaactcaatgtatggtctggcagcggcagtgtttacaaaggacattgataaagct
cacactttctctcagtcagtaagagctggtactgtctggattaactgctatgatgttttt
ggagctcaagccccctttggagggtacaaggcatcaggaatagggagagagcttggagag
tatggacttgaagcatacacagaagtgaagaatgtcaccattaagattccccagaagaat
tcttaa

DBGET integrated database retrieval system