KEGG   Xenopus laevis (African clawed frog): 447370Help
Entry
447370            CDS       T01010                                 

Gene name
ogdhl.L, ogdhl
Definition
(RefSeq) oxoglutarate dehydrogenase-like L homeolog
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00020  Citrate cycle (TCA cycle)
xla00310  Lysine degradation
xla00380  Tryptophan metabolism
xla01100  Metabolic pathways
xla01200  Carbon metabolism
Module
xla_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xla_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
xla_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    447370 (ogdhl.L)
  09105 Amino acid metabolism
   00310 Lysine degradation
    447370 (ogdhl.L)
   00380 Tryptophan metabolism
    447370 (ogdhl.L)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     447370 (ogdhl.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N GGA_N-GAT
Motif
Other DBs
NCBI-GeneID: 447370
NCBI-ProteinID: NP_001087546
Xenbase: XB-GENE-984155
UniProt: Q68EW0
LinkDB All DBs
Position
7L
AA seq 1018 aa AA seqDB search
MSHLRSVAAKLKPYCTGLLVKHNSILRTLPPRCYVYSSGAKEPFLSGTNSSYVEEMYYAW
LENPKSVHKSWDAFFRSADNGTPQCEIQGVPSLADIESKLPSLSSQGLATAPAKAEKIVE
EHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSFVPSDLITTLDKLGFYGLHEGDLDKV
FRLPTTTYIGGTDSTLSLREIIRRLENSYCQHIGLEFMFINDVEQCQWIRQKFETPGIMK
FINEEKRTLLARLIRSTRFEDFLARKWSSEKRFGLEGCEVMIPALKAIIDKSSEMGLEYV
ILGMPHRGRLNVLANVIRKDLDQIFCQFDPKLEASDEGSGDVKYHLGMYHERINRATNKK
ITLSLVANPSHLEAVDPVVQGKTKAEQFYRGDTEGNKVMSILVHGDAAFAGQGVVYETFH
LSDLPSYTTNGTIHIVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVMY
VCSVAAEWRNTFNKDVVVDLVCYRRSGHNEMDEPMFTQPLMYKQIHKQVPVLKKYADKMI
AEGTVTLQEFEEEIAKYDRICEEAYARSKDKKILNIKHWLDSPWPGFFTLDGEPKSMTCP
PTGIPEDMLSHIGAIASSVPLKDFKIHGGLSRILKSRLEMTNSRTVDWALAEYMTFGSLL
KEGIHVRLSGQDVERGTFSHRHHVLHDQEVDRWTCVPMNHLWPNQAPYTVCNSSLSEYGV
LGFELGFAMASPNALVLWEAQFGDFYNTAQCIIDQFISSGQAKWVRHNGIVLLLPHGMEG
MGPEHSSARPERFLQMSNDDSDAYPEFTQDFDVSQLFDCNWIVVNCSNPASYFHVLRRQI
LLPFRKPLIIFTPKSLLRHPEAKSSFDDMKTGTNFQRVIPENGAASHSPQEVKRVIFCTG
KVYYELVKERHRKGLDSQVAITRLEQISPFPFDLVKQEAEKYATSELVWCQEEHKNMGYY
DYVKARFLTILNHARPVWYVGRDPAAAPATGNKNTHHVELRRFLDIAFDLEYFEGKPF
NT seq 3057 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacctcaggtcagttgctgctaaattaaaaccatactgtactggtttgcttgtg
aaacacaactccatcctcaggacattgcccccaagatgttatgtgtattcatcaggagcc
aaagaacctttcttaagtggaaccaattccagttatgtggaagaaatgtattacgcatgg
ctggagaatccaaaaagcgtccataagtcctgggatgcatttttccgaagtgctgataat
ggaacccctcagtgtgaaatacaaggtgtaccttctttggctgatatagagagtaaattg
ccttccctttctagccaaggtttggccacggcaccagccaaagcagagaagatagtggaa
gagcatctggctgtgcaatctttgattagagcctaccagatccgtggacatcatgttgca
cagctggacccactaggaatcttagatgcagacttagactcatttgttccttctgatcta
atcacaacacttgataaactaggcttttatgggttgcatgaaggagatctggacaaagtt
ttccgcttgccaacaaccacatatattggaggaaccgattctaccctgtctctgcgagag
attatcagaagattggagaattcatattgtcaacacattgggctggagtttatgtttatc
aatgatgtagaacaatgccagtggattcgacaaaaatttgagacccctggcattatgaag
tttataaacgaagagaagcgaacacttctagccaggctcatacggtctaccaggtttgaa
gacttcctagcacgcaagtggtcatctgagaagagattcgggttggaagggtgtgaggtc
atgattccagcattgaaggcaatcatagacaagtctagtgagatgggactggaatatgtc
atactagggatgcctcacagaggcagactcaatgtactggcaaatgtgattcgaaaagat
ttagaccagatcttctgccagtttgaccctaagctggaggcttcagatgagggatcaggg
gatgtgaaatatcacttgggaatgtaccatgaacgcatcaatcgtgccacaaacaagaaa
attaccttatctttggttgctaatccctcccatctggaagctgtggatcctgtggtacaa
ggtaaaactaaagcagaacagttttatcgaggagacactgaaggaaataaggtaatgtca
atactggttcatggtgatgctgcctttgctggacaaggtgttgtatatgaaacattccac
ctcagtgaccttccttcatacaccaccaacggaacaatccatattgttgtcaataatcag
attggatttaccacggatcctcgaatggctcggtcttctccataccccacagatgtggca
cgtgtggttaatgcacccatattccatgtaaatgcagatgaccctgaagctgtaatgtac
gtgtgcagtgtggctgctgagtggaggaatacctttaataaagatgtagttgtggatttg
gtgtgttaccgtcgtagtgggcacaatgaaatggatgaacccatgttcactcagcccttg
atgtacaaacagattcacaagcaggtgccagtcctcaaaaagtacgcagacaaaatgatt
gccgagggcacagttactctgcaagagtttgaggaagagattgcaaagtatgatagaatt
tgtgaagaggcctatgcgaggtccaaagataagaaaattctcaacataaagcactggttg
gactcaccatggccaggatttttcactttagatggtgaaccaaagagtatgacttgtccc
ccaactggtattcctgaagacatgctttcccatattggtgctatagccagttcagtgcct
ttgaaagactttaaaattcacggaggactctctaggattttgaagagcagactggaaatg
accaatagtcgtacagtcgattgggcactggcagaatacatgacgtttggatctttgctg
aaagaaggaatccatgttaggcttagtggccaggatgtagaaagaggaacgtttagtcat
cgtcatcatgtcctgcacgatcaggaggtggaccgttggacttgtgttccaatgaatcat
ctttggccaaaccaagctccatacacggtgtgcaacagttccttgtctgaatatggcgta
cttggttttgagcttggctttgctatggcaagccccaatgctttagtgctttgggaagca
cagtttggtgatttttataatactgcccaatgcataattgaccagtttatcagctcggga
caagctaagtgggttcgtcacaatggaattgtgctactgctgccgcatggaatggaagga
atggggcctgagcattcatcagccagacctgaaaggtttctgcagatgagcaatgacgac
tctgatgcttatcctgaatttacacaggactttgacgtttcccaactctttgactgtaat
tggattgtggtgaactgttcaaacccagccagctattttcatgttctcagaagacaaatt
ctgctgcccttccgtaaacctctaattatttttacccccaaatcattgctgaggcaccca
gaggcaaaatctagctttgatgacatgaaaacaggtaccaatttccagcgtgtgattcct
gaaaatggtgcagcttcccacagtcctcaggaggttaaaagggtcattttctgcactggg
aaagtttattatgagctggttaaagagagacaccgcaaagggttggatagccaagtagct
atcaccaggctggagcagatctccccgttcccttttgatttggtgaagcaagaagctgag
aagtatgccacctcagaactggtttggtgccaagaagaacacaaaaacatgggatattat
gactatgttaaagcacgttttctcaccatcctaaaccatgcaaggcctgtttggtacgtt
ggtcgggacccagcagcagctccagccactggaaataagaacactcatcatgtagaactc
aggagatttctggatattgcctttgatctggaatattttgaaggaaaacctttctga

DBGET integrated database retrieval system