KEGG   Xenopus laevis (African clawed frog): 447412Help
Entry
447412            CDS       T01010                                 

Gene name
cnih1.S, cnih, cnih1
Definition
(RefSeq) cornichon family AMPA receptor auxiliary protein 1 S homeolog
  KO
K20368  protein cornichon
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xla04131]
    447412 (cnih1.S)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xla02000]
    447412 (cnih1.S)
Membrane trafficking [BR:xla04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    447412 (cnih1.S)
Transporters [BR:xla02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   447412 (cnih1.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cornichon
Motif
Other DBs
NCBI-GeneID: 447412
NCBI-ProteinID: NP_001087588
Xenbase: XB-GENE-1004748
UniProt: Q66KH5
LinkDB All DBs
Position
8L
AA seq 144 aa AA seqDB search
MAFTFAAFCYMLALLLTAALIFFAIWHIIAFDELKTDYKNPIDQCNTLNPLVLPEYLIHA
FFCIMFLCAAEWLTLGLNMPLLAYHIWRYTSRPVMSGPGLYDPTTIMNADILAYCQKEGW
CKLAFYLLSFFYYLYGMIYVLVSS
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcacgttcgcggccttttgttatatgctggctttgcttctgacggcggcgctc
atcttttttgctatctggcacattattgctttcgatgaattgaaaaccgactacaaaaat
cctatagaccaatgtaacaccctcaaccctcttgtacttcctgagtatctgattcatgct
ttcttctgtatcatgtttctgtgtgctgcggagtggctaaccttgggtttaaacatgcct
cttttggcttaccatatttggaggtatacgagtaggccggtcatgagtggaccaggactg
tatgatccaacaacaatcatgaatgctgatatactagcctactgtcaaaaggaagggtgg
tgcaagttagctttttaccttctgtcatttttttactacctgtatggaatgatctatgtg
ctggtgagctcctaa

DBGET integrated database retrieval system