KEGG   Xenopus laevis (African clawed frog): 447452
Entry
447452            CDS       T01010                                 

Gene name
gtse1.S, gtse1
Definition
(RefSeq) G2 and S-phase expressed 1 S homeolog
  KO
K10129  G-2 and S-phase expressed protein 1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    447452 (gtse1.S)
SSDB
Motif
Pfam: GTSE1_N
Other DBs
NCBI-GeneID: 447452
NCBI-ProteinID: NP_001087628
Xenbase: XB-GENE-17330320
UniProt: Q66J92
LinkDB
Position
3S
AA seq 664 aa
MQAGGDFTLLADEKFDFDISLSPTSSKEGNGDCDDEVFIGPVRHKEKCVSASISEESDKG
SPSLLNEDVPWSPLSGDKFVEIFKEAHLVALQLECFANDDTKEDLSTQNDTNQLVEKFVQ
ESKNKLNIFENMDNSKTPIALKRETYCVQDSPFNQLPPSVQQRLVMSGTGGEKKSALNSA
NHTSPVKMPRPTKGLSVSPLVQKSKVVQTKSTAPVANSKKTISRLQPIKATSLATKANHL
TVEKSKSIRKISPVRKKHLSSAGSSEDIYSDKSSVASDISDSSFNSSIAGQNKRTLPAPG
KIGLKKTQFKAPSNGAMLRKNTSSSSSSLSSMNASLNSSMSTSPPSRNAKLNSSLNVSVN
ASRLKPNQSRLSLVQPSGGSASTVKTNVPEMSKSRLKPNSTLKSVTVENCNKLSSVSVAL
PKTPAGKMQRQTSAPNLNRMPVPNKPESAIKGSSCSKPQSKLMPTPTSRLKLPQRATGVS
PDRSVLKTLQPTRLMSCGDLGSGIAESTPLRSTQGTATSNSSVARSVSTTPSTKQISSLP
TPLSRRTSSALMTPRTIPRSISSQRTVQALQASAKPNKKPLVNGQKEGPKTASSPGSPTE
DLSSADVIPCSLKFSPESKNMPVNGKETPKSSNKELIDLSSPLIQLSPGLNKENIVFDSP
LLKF
NT seq 1995 nt   +upstreamnt  +downstreamnt
atgcaagctggtggggatttcactctcttggctgatgagaagtttgattttgacatatcg
ttgtctcctacaagttccaaagagggcaatggagactgtgacgacgaagtatttattggg
cctgtaaggcacaaagagaagtgtgtcagtgcttctataagtgaagaatcggacaaaggg
agtccttctctgttaaatgaagatgttccttggagtcctttaagtggcgataaatttgtt
gagatcttcaaggaagctcatttagtggcattgcagctggaatgttttgcaaatgatgac
acaaaggaagacttgtcaactcagaatgacacaaaccaattggttgaaaagtttgttcag
gagtctaaaaacaagttaaatatttttgaaaacatggacaatagcaaaactccaattgcc
cttaaaagagagacatattgtgtgcaagatagcccatttaatcagcttcctccttcagtt
cagcaaagacttgttatgtctggcacaggcggagaaaagaaatctgctttgaatagtgca
aatcataccagccctgtgaaaatgcctagaccaacaaagggactttctgtttcaccacta
gtgcagaagagcaaagttgtgcaaaccaaaagtactgctccagtggcaaactctaagaaa
actataagccgcttgcagcccatcaaagcaacgtctttggcaacaaaagcaaatcacctt
actgtagaaaagtcaaaatctattaggaagatcagcccagttagaaagaaacatctcagt
agtgctggctcctcagaagatatttattctgacaaatccagtgttgcatcagatatcagt
gattcttcattcaacagcagcattgcaggacaaaacaaaaggacacttccagctccaggc
aagattggcctgaaaaaaacacagtttaaagctccatccaatggtgcaatgcttagaaaa
aatacctcctcttcatcttcctcactttccagcatgaatgccagtttaaattcaagcatg
tctacatctccgccttctagaaatgccaaacttaacagttctctgaatgtctcggtaaat
gcttcgaggctgaaacctaatcagtccaggttgtcattagttcaaccttctggcgggtct
gcctccactgtcaaaacaaacgttcctgagatgtcgaagagccgccttaaaccaaacagc
acactaaaatcagtaactgttgaaaattgcaataaattatcatctgtgtctgttgctcta
ccgaagacaccagcaggcaaaatgcagaggcagacctctgcacctaatctaaacagaatg
cctgtgccaaataaaccagaaagtgctattaagggctcatcctgttccaagccacaatca
aaattaatgcctacaccaacaagccgtctcaagctgcctcagagggctacaggagtatcg
cctgatcggtctgtgctaaagacattgcagccaactcgcttaatgtcctgtggtgatctt
ggaagtggtatagctgaaagcactccactgagatcaacacaaggcactgcaactagcaat
tcctctgttgcaagatctgtttccactacacccagtacaaagcaaatatcttctttgcct
actccactgagtcggaggacatcttctgctctgatgacaccaaggacaatcccacgatcc
atttcatctcaacggacagtgcaagctctgcaggcttcagcaaagcccaataagaaacct
cttgtgaatgggcaaaaagaaggcccaaaaacggcttctagtccaggctctcccactgaa
gatctttcttcagcagatgtgattccttgttctttgaagttctctcctgaaagcaaaaat
atgcctgtaaatggaaaagaaactcctaaatcttcaaacaaagagctgatagatttgagt
tctcctcttatccagctgagtcctggactgaacaaagaaaatatagtatttgattctcca
ctcctgaagttttga

KEGG   Xenopus laevis (African clawed frog): 734417
Entry
734417            CDS       T01010                                 

Gene name
gtse1.L, gtse1
Definition
(RefSeq) G2 and S-phase expressed 1 L homeolog
  KO
K10129  G-2 and S-phase expressed protein 1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    734417 (gtse1.L)
SSDB
Motif
Pfam: GTSE1_N
Other DBs
NCBI-GeneID: 734417
NCBI-ProteinID: NP_001089367
Xenbase: XB-GENE-1014607
UniProt: Q566H8
LinkDB
Position
3L
AA seq 724 aa
MQAGGDFTLLADEKFDFDISLSPTSSKEGNEDCDDEVFIGPVRHKEKCVRASVQSEESDK
GSPSSLLNDNVAWSPLSGDKFVEIFKEAHLVALQLESFANDDPKEDRSAQSDTNQLVEKF
VQESKSKLNIFENVDNSKTPIALKRETYCVQESPFNQLPPSVQQRLAMSGTVGEKMSALN
KANHTSPGKMPRPTKGLSFSPLVQKSKVVHAKSTVPVANSKKTLSRLQPIKATSLATKTN
RLTVEKSISSRKISPVRMKHLSSAGSSEDIYSDKSSVASDISDSSFNSSIAGQNKRTLPA
PGKIGLKKTQFKAPPNGAMFRKNTSSSSSSHSSMNASLNSSMSTSPPRGNAKLNTSMNVS
INASRLKSNQSRLALVHPSGGSTSSVKNVPDMSKSRLKPSSTVKPGTVGNCSKSALVSVA
LPKTPSGKMQRQTSAPNLNRMPVPNIPESAIKGSSCSKPQSKVMPTPTSRLRLPQRATGV
SPDRSVLKTLQPIRLMSCGDIGSGIAESTPMKSTQGRESTSASVARSVSATPSTKHISSL
PTPLSRRTSALMTPRTIPRSISSQRTMQALQTSAKSIKKPLMNGQEESKGKSTKMTSSPV
SPTEDLAVADVIPCSLKFSPESKNIPVNGKEPPKSLCSSNKEVLLVDIEELKHETDAKLR
KHSSAGSDGYPLIDLSNTPDFNKIIVPIKPAIVGQLIDLSSPLIQLSPVLNKENIQFDSP
LLKF
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgcaagctggaggtgatttcactctcttggctgatgagaagtttgattttgatatatcg
ttgtcccctacaagttccaaagagggcaatgaagactgtgatgatgaagtatttattggg
cctgtaaggcacaaagagaagtgtgtccgtgcctctgtgcaaagtgaagaatcagacaaa
gggagtccttcttctctgttaaatgacaatgttgcttggagtcctttaagtggtgataaa
tttgttgagatcttcaaggaagctcatttagtggcactgcagctggaaagttttgccaat
gatgacccaaaggaagaccgctccgctcagagtgacacaaaccaattggttgaaaagttt
gttcaggagtctaaatccaagttaaatatttttgaaaatgtggacaatagcaaaactcca
attgcccttaaaagagagacttattgtgtacaagaaagcccctttaaccagcttccccct
tcagttcagcaaagacttgctatgtctggaacagttggagaaaagatgtctgctctgaat
aaggcaaatcataccagccctgggaaaatgcctagaccaacaaagggactttctttttca
ccactagtgcagaagagtaaagttgtgcatgccaaaagtactgttccagtggcaaattct
aagaaaactttaagccgcttgcaacccatcaaagcaacgtctttggcaacaaaaacaaac
cgccttactgtagaaaagtcgatatctagtaggaagatcagcccagttagaatgaaacat
ctcagtagtgctggctcttcagaagatatttattctgacaaatccagtgttgcatcagat
atcagtgattcttcattcaacagcagtattgcaggacaaaacaaaaggacacttccagcc
ccaggcaagattggcctgaaaaaaacacagtttaaagctccacccaatggtgcaatgttt
agaaaaaatacctcctcttcatcttcctcacattccagcatgaatgccagtttaaactca
agcatgtctacatctccacctcgtgggaatgccaaacttaacacttctatgaatgtttca
ataaatgcttccaggctgaagtctaatcagtctaggctggcattagttcatccttctggt
gggtccacctcctctgtgaaaaatgtacctgacatgtcaaagagccgccttaaaccaagc
agcacagtaaaaccaggaactgttggaaattgcagtaaatcagcattggtgtctgtggct
ctaccgaagacaccatcaggcaaaatgcagaggcagacctctgcacctaatttgaacaga
atgcctgtgccaaatataccagaaagtgcaattaagggctcatcctgttctaagcctcaa
tcaaaagtaatgcctacaccaacaagccgtctcaggctgcctcagagagctacaggagta
tcgcctgatcgatctgtgctaaagacattgcagccaattcgattaatgtcctgtggcgat
attggaagtggtatagctgaaagcactccgatgaaatccacacaaggcagagaatccacc
agtgcctctgttgcaaggtctgtttctgctacacctagtacaaaacacatatcttccttg
cctactcctctgagtcggagaacttctgctctgatgacaccaaggacaatcccaagatcc
atctcatcccagaggacaatgcaagctctgcagacttcagcaaagtccattaagaagcct
ctcatgaatgggcaagaagaatctaaaggcaaaagcacaaaaatgacttctagtccagtc
tctcccactgaagatcttgctgtagcagatgttattccttgctctttgaagttctctcct
gaaagcaaaaatatacctgtaaatgggaaagaaccccctaagtcactctgttcttcaaac
aaagaggttttactggttgatattgaagagctaaaacatgaaaccgatgctaaactgagg
aaacactcatccgctggaagtgatggttaccctctaattgacctttcaaacacacccgat
tttaacaaaataatcgttccaataaaaccagcaattgttggtcagctgatagatttgagt
tctcctcttatacagctgagtcctgtgctgaacaaagaaaatatacaatttgattctcca
ctcctgaagttttga

DBGET integrated database retrieval system