KEGG   Xenopus laevis (African clawed frog): 447454Help
Entry
447454            CDS       T01010                                 

Gene name
setd1b.S, setd1b
Definition
(RefSeq) SET domain containing 1B S homeolog
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    447454 (setd1b.S)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xla03036]
    447454 (setd1b.S)
Enzymes [BR:xla01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     447454 (setd1b.S)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     447454 (setd1b.S)
   HMT complexes
    COMPASS/SET1 complex
     447454 (setd1b.S)
    COMPASS/SET1 complex (yeast)
     447454 (setd1b.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1 RRM_5 SGP
Motif
Other DBs
NCBI-GeneID: 447454
NCBI-ProteinID: NP_001087630
Xenbase: XB-GENE-5842376
UniProt: Q66J90 A0A1L8HQP3
LinkDB All DBs
Position
1S
AA seq 1938 aa AA seqDB search
MSFKEAKPGERGKNPEDHGRKQAASWMNGMEAANQPSTSAEKKSHHWRSYKLIIDPALRK
GQQKLYRYDGLSFSMPNSGAPPVDSVRDPRIGRIWTKTKELDLPVPKLKIDEFYVGPVPP
KQVTFAKLNDNIRENFLGDMCKKYGEVEEVEILYNPKNKKHLGIAKVIFATVKGAKDAVK
HLHNTSVMGNIIHAELDTKGETRMRFYELLVNGYYTPQTLPVGSDLDASPTVNETPQVVE
PVKRTKETAVGASVTPNSSTPFSHDTAYSSSRQGTPNSYSQFTPQSQGTPHTPRLGTPFS
QDSSYSSRQTTPAFHYGQDSSFKPRRHENKFTDAYNRRPGHHYVHSSGSYRGPENTFNVT
RPQAETVQFPRTPPLSHSSGNNKSAFSPYQGSTVFPQTDDNQYPQTSRDMEYRRTGPPTS
DSYSDGSLELKLVKEKPEEPPPPEPDSTTEQKASFAQTPERCATPGTPTLEAEMQHDSLD
TRIAMLLKEQRTQLHLISSDQNSDSEIRMEGSPISSSSSQLSPIPPYSSSSHYQDVTPSS
RPSSTGLEDISPTPLPDSDDDEPIPGTASLCQNSRSASPIDQINQPVRKMETLDNKELVV
GDETPTSEKMDEGHPSSGEDMEISDDEVTPSPITSAECAITSSSVIPILPPGFPPLPPPP
PPQSGFPMPPPLPPPPPPTHPSVTVPPPPLPAPPGVPPHHILHHPPPYHHFPVMQGEMMN
VLGNHWGGMTMSFQMQTQMLSRMMQGQGSYPYHHFMGGSMQFGNQLPYRPFALSAHLSRG
QPWPPLPKFDPSVPPPGYEPKKEDPHKATVDGVLQVIVKELKAIMKRDLNRKMVEVVAFR
AFDEWWDKKERLAKQSLTPVKSGESKDEDKQKTKEHITSSLLESWNKGEGLGFEGIGLGI
GLRGAIRLPSFKVKRKEPPDAALAGDQKRIRPSHSVDDEDEESERDRDISGTASDLSKKD
ADAVNIRRRPARPLDSEGEEEVESEGDDGETSDKEAFEKEDQDAGSVSALSSKKRLYGEK
EDEEDETQSSGKEEDLVSEEEDITSVASSRAEMDSSDESDESSEYESSSDSDDEIEEEDD
DDEEEELVFEDDQSEELDLGQEDYIETDREEDFFKEDVSECSSPVKAEADMELEDDDVQK
LEQDVAHQTAQDTSHLRKKDLDVPLVESKEHKQDTFDKMERLSAVPMQQNVFKEHEKAPS
PMNEEEEYIELRLEPVPLVPDNAPPAVQEPMIIRPLTPTGAFGESGPVLKLEEPKLQVNL
AHFVAEDEDLYPRTPGRDTAAHSDTEVTFQPGLKVAPSSLPLLQSHNKEEECLLPPEKHT
GHLKVTKTLSEEELPRTPGRDILVKSSHLGKSQSTETIPATPGSDAPLTGNSLTLTSPHI
PGSPFSYLSQSPGIINSGIPRTPGRDFNFTPIFPESNSIFPSHPSGKKSSVDEPDEKSFK
EPTSASLTMNSVPSPIPFASPPRGVPHMDIRLETDDLESSDTQAYLSDKLLSEESECEFT
KGQLPSTDESAPSPPFPPTDKRKGPKKPLAAHEFEACVALSEGALGKQLFIGQPDSVSGI
KDPAAVPLDFRNDGLSENTVHDPIIQKVPLKELENQWNEVLKEEEEDISKHKKSRNSRLN
KLYDEFSTLPSPEYSPPRAMFKPRSEFEEMTILYDIWNGGIDDEDMKYMCITYDRLLQQD
NGMDWLNDTLWVYHPPTSVYSPKKKKRDDGLREHVTGCARSEGYYKIDKKDKLKYLINNR
SLADEPPIDTQGKSIPAQPQASTRAGSERRSEQRRLLSSFTGSCDSDLLKFNQLKFRKKK
IRFCKSHIHDWGLFAMEPIVADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDH
DTIIDATKCGNFARFINHSCNPNCYAKVVTVESQKKIVIYSKQYINVNEEITYDYKFPIE
DVKIPCLCGAENCRGTLN
NT seq 5817 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcaaggaggccaagcctggggagagaggcaagaacccagaagaccatggcaga
aagcaggctgcaagctggatgaacggcatggaggcggccaaccagcccagcacttcggcc
gagaagaagagtcaccactggcggagttacaagttgatcattgacccggctctgcggaag
gggcaacaaaaactctatcgttacgatggtctcagcttcagcatgcctaactccggggcc
cccccagtggatagcgttagagatccccggatcggacgtatatggaccaaaacgaaagag
ctggatttgcctgtccccaaactcaagatcgatgagttttatgtaggaccagtgcccccc
aagcaagtgacgttcgctaaactcaacgataacatccgcgaaaacttcctgggggacatg
tgcaagaaatacggcgaggtggaagaggtggagatcctgtacaaccctaaaaacaagaaa
cacctgggcattgccaaagtcatattcgccaccgtgaaaggcgccaaggacgccgtgaaa
catttgcacaacacctcggtcatgggcaacatcattcacgcggagctggacacgaaaggt
gaaacgcgtatgcgattctatgaacttttggttaatggttattatactcctcagactctt
ccagttggaagtgatctggatgcctctcctactgtgaatgaaaccccacaggttgttgag
ccagtgaaacgtacaaaagagactgccgttggtgcatcagttaccccaaatagcagtact
cctttttcccatgatacagcctattcaagctctcggcaaggtacgcctaattcttacagc
cagtttacaccacagtcgcaagggactcctcatactccccgcttgggtacccctttctca
caggattccagttattccagtcgtcaaacgacaccagcttttcattatggacaggactct
agttttaaaccaaggagacatgaaaataagtttacagacgcttataatagaaggccaggc
caccactatgtgcacagttctgggtcctaccgggggcctgaaaacacatttaatgtgacc
agaccccaagcagaaaccgtgcagtttccccgaactccacccttgagtcattctagtggg
aataataaatccgcattttcaccttatcaaggaagtactgtttttcctcaaacggatgac
aaccagtatccgcagacatcaagggatatggagtacagaaggacaggacctccgacttca
gattcatattctgatggcagtttagaactgaaactagtaaaagagaaaccagaggaacct
ccacctccagagcctgactctaccacagagcaaaaagcatcatttgcgcagaccccagag
aggtgtgcgacacctggaactccaactctggaggctgaaatgcagcatgacagtttggac
acacggattgcaatgctattaaaagagcaaagaacccagctgcatttaatttctagtgat
caaaattcagacagtgaaataaggatggagggaagtccaatatcatcctcttcctcgcag
ctttcccctatacctccttatagttcaagctcccattaccaggatgttaccccttcatcc
cgaccctcaagcacgggattagaggatattagcccaacccctttgccagattctgatgac
gatgagccgattcctggcactgcctccctttgccagaactcaaggtcagcatctcccata
gaccagattaatcagcctgtgagaaaaatggagactctggataacaaggaacttgtagtg
ggtgatgaaaccccaacatctgagaaaatggatgagggtcatccttcctctggagaggac
atggagatctccgatgatgaagttaccccttctccaatcactagtgcagagtgtgccata
actagttcatctgtcattcctatactaccaccagggtttccccctctgccgccaccacct
cccccacagtctggatttcctatgccgcctcctttacctcctccaccacctcctacccat
ccttcagtaacagtacccccacccccattgcctgcaccacctggggtgcctccacatcac
atattgcatcatccacctccatatcatcatttccctgtgatgcaaggggaaatgatgaat
gttcttgggaaccattggggtgggatgacaatgtccttccaaatgcaaactcaaatgctc
agccgcatgatgcaagggcagggttcttacccctaccaccatttcatgggaggctccatg
cagtttggtaaccagctaccttatcgcccctttgctttatctgcacacctttccagagga
cagccttggccacccttaccaaaatttgatccatctgtaccaccaccaggctatgagcct
aaaaaggaggaccctcacaaagcaacagtggatggagtcttgcaagtcatagtcaaggag
ctgaaagctataatgaaaagagatttgaaccgcaagatggttgaggtggtggcttttagg
gcatttgatgaatggtgggataaaaaggaacgtttggcaaagcagtctttaacacctgta
aaatctggagagagcaaagatgaagataaacaaaagactaaggagcatataacctctagc
ctcctagaaagctggaataaaggggaaggattaggttttgagggcattggactgggcatt
ggtctacgtggtgcaatccgacttccctcttttaaggtaaagcggaaagaacctcctgat
gccgcactggctggagatcaaaagaggattcgcccatcacattcagtagatgatgaggat
gaagagtctgaaagagatcgtgatatctcgggtacagcatctgatttatcaaagaaagat
gcggatgcagtaaacatccgaagaaggccagcaagacccttagacagtgaaggggaagaa
gaggttgaaagcgaaggagatgatggggagacgtcagataaagaagcctttgagaaagag
gaccaagatgctggttctgtctctgctttgtctagtaaaaaacggctgtatggagaaaaa
gaggacgaggaggatgagacacaaagcagtggtaaagaagaggatcttgtttcagaagaa
gaagatatcaccagtgttgcttcctcaagagctgagatggattcttctgatgaaagtgat
gaatcttcagagtatgagtcaagctcagattcagatgacgaaatagaggaagaagatgat
gatgatgaagaagaagagctagtttttgaggatgatcagtctgaggaactagatttaggt
caggaagattatattgaaactgatagggaagaagacttcttcaaggaggatgtatctgag
tgcagcagtccagtaaaggcagaggcagatatggaattagaagatgacgatgtgcaaaaa
ttagaacaagatgttgcacaccaaacggcacaagatacatcacatcttagaaagaaagac
ttggatgtaccattggtggaatctaaagaacacaaacaggatacctttgataagatggag
aggctttctgctgtacccatgcaacagaatgtttttaaagaacacgaaaaagcaccatca
ccaatgaatgaagaggaagagtatatagagcttcgtttagaacctgtgcctttggttcca
gacaatgcacctccagctgtacaagagcctatgatcatccgtcccttaacaccgactggt
gcttttggtgaatctggccctgttctcaaacttgaagaacccaagctgcaagttaattta
gctcattttgttgcagaagatgaagacctgtaccctcgcacacctggccgtgacacagct
gctcattcagatacagaggtcacgtttcagcctggtttgaaagtggctccatccagcctt
cctcttttgcaaagtcacaataaggaagaggagtgtttgcttccccctgaaaagcatact
ggtcacttaaaggtgactaagacgttgtcagaggaagaactaccccgtacaccaggcaga
gatattttagttaagtcctcccaccttgggaagtctcagagtacggagaccattcctgca
actccaggtagtgatgctcccctcacaggtaacagccttacactgacttctccgcacata
cctggcagtcctttttcttatctctcccagtcaccaggaataattaacagtggtattcca
aggacacctggaagagattttaacttcaccccaattttcccagaatcaaattcaatattc
ccttcccatccttctggcaagaaatcatctgtagatgaaccagatgaaaagtcatttaaa
gaaccaaccagtgcttccttaactatgaatagtgttccttcacccatcccatttgctagc
ccgcctagaggggttccacacatggacataaggttagagacggatgatctggaatcatct
gatactcaagcatacctttctgataaattattaagtgaggagagcgaatgtgagtttact
aaagggcagctcccttccactgatgaatctgcaccctcaccacctttccctcctacagac
aagaggaaaggacccaaaaaacctcttgctgctcatgaatttgaggcttgtgttgctttg
tcagaaggtgctttgggtaaacaattgtttattggacaacctgattctgtcagtggtatt
aaggatccagcagctgtgccactggactttaggaatgatggcctttctgaaaacacagtt
catgatcccattattcaaaaagtccctttaaaagagttggaaaatcagtggaatgaagtt
ttaaaagaggaggaggaggatataagtaaacataaaaaatcaaggaactccaggcttaac
aaactatatgatgagttttcaactttaccttctcctgaatattccccgccccgagctatg
tttaagcctcgctctgaatttgaggaaatgaccattctgtatgatatatggaatggagga
atagatgatgaagatatgaaatacatgtgcataacctatgacagactgttacagcaagat
aatggcatggactggctcaatgacacattatgggtgtaccaccctccaaccagtgtttat
tcccccaagaagaagaagcgggatgatggtttacgggagcatgtaacaggatgtgcccgc
agtgagggatattataaaattgataagaaagataaacttaaatacctcatcaacaaccgt
tctttggctgacgagcctcccatcgacacccagggaaagagtatcccagctcagcctcaa
gcctccacccgagcaggctcggaaagaaggtcagaacagcgcagactgctctcttccttc
actggtagctgtgacagtgacttgctcaaatttaatcagctgaagttccgaaagaaaaag
atacgtttctgcaagagccatatacatgactggggtctttttgccatggaaccaattgta
gctgatgagatggtgattgagtatgtcggacaaaatattagacaggtaattgcagatatg
cgggaaaagcgatatgaggatgaaggaatcggcagcagttatatgtttagggtggaccat
gacactatcattgatgcaacaaaatgtgggaattttgcacggttcattaaccacagctgt
aatcctaattgctatgcaaaggttgttactgtggagtctcagaagaagattgtgatctac
tctaaacagtatatcaatgtgaatgaagagataacatatgattacaagttccctatagag
gacgtgaagattccctgtctttgcggagcagagaactgcagagggacgctaaattag

DBGET integrated database retrieval system