KEGG   Xenopus laevis (African clawed frog): 447460
Entry
447460            CDS       T01010                                 

Gene name
lpar2.S, lpa2, lpar2
Definition
(RefSeq) lysophosphatidic acid receptor 2 S homeolog
  KO
K04291  lysophosphatidic acid receptor 2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04080  Neuroactive ligand-receptor interaction
xla04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    447460 (lpar2.S)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    447460 (lpar2.S)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:xla04030]
    447460 (lpar2.S)
G protein-coupled receptors [BR:xla04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    447460 (lpar2.S)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 447460
NCBI-ProteinID: NP_001087636
Xenbase: XB-GENE-5791382
UniProt: Q66J84
LinkDB
Position
Un
AA seq 344 aa
MNQCFYNESIKFFYNNSGKELYDTWRTKDKLVVVLGLTVCVFVMLFNLLVITAIIINRRF
HYPIYYLLGNLAAADLFAGVAYTYLMFHTGPNTSKLTIKTWLVRQSLLDTSLTASVANLL
AIAVERHQTIFTMQLHSKMSNQRVFILIACIWIIALLLGLIPSFGWSCICNISACSRMAP
LYSRSYLIFWAVSNLVAFLIMMGVYLHIFIYVKRKMTRMSQHTSSQPKYRETMINLMKTV
FIILSAFVICWTPGQVVLLLDGLNCKSCNVLAVEKYFLLLAEINSVINPIVYSYRDNEMR
LTFKQILCFCCNRGSKYSPASLKSTNTERRVLADNGHSMRECSL
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgaatcagtgcttttataatgagagtattaagttcttttacaacaatagcgggaaagaa
ctctatgacacatggaggaccaaggacaagctggtggtggttttgggacttacagtgtgt
gtctttgtgatgttgttcaacctgcttgtgataaccgccattatcatcaacagaagattc
cactatccaatctattatctcctggggaacctggctgcagccgacctgtttgctggggtt
gcttatacctacctcatgttccacacggggccaaatacatctaaattaaccataaagacc
tggctcgttcgacaaagtctactggacactagtttgacagcatcagtggccaacttactg
gccatagctgtagaaaggcaccagacaatattcaccatgcagctccatagcaagatgtca
aaccaacgagtgttcatccttattgcctgcatatggattatagcgttgttgctgggtctg
atcccatcttttggttggagttgtatttgcaacataagtgcttgttccagaatggctcct
ctttatagcaggagctacctgatcttctgggcagtatccaacttggtggcctttctgatc
atgatgggggtctacttgcatatctttatctacgtcaagaggaagatgacaaggatgtcc
cagcacacgtcgtctcaacccaagtatcgggagaccatgataaacctaatgaaaactgtc
ttcattatcttaagtgcctttgtgatctgctggacacctggccaagttgtcctcctcctg
gatggtttaaattgtaagagctgcaacgttctggctgttgagaagtatttcctgctcctg
gctgagatcaattccgtcatcaatcctattgtatactcttatcgggacaatgagatgaga
ctcacattcaagcagattctttgcttctgctgcaacaggggctccaaatactcaccggct
tcccttaagtcaactaatacagagaggagagtcttggctgacaatggacactcaatgaga
gaatgcagtctttag

DBGET integrated database retrieval system