KEGG   Xenopus laevis (African clawed frog): 447541
Entry
447541            CDS       T01010                                 

Definition
(RefSeq) MGC83948 protein
  KO
K04503  G1/S-specific cyclin-D1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04115  p53 signaling pathway
xla04218  Cellular senescence
xla04310  Wnt signaling pathway
xla04340  Hedgehog signaling pathway
xla04371  Apelin signaling pathway
xla04510  Focal adhesion
xla04530  Tight junction
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    447541
   04340 Hedgehog signaling pathway
    447541
   04371 Apelin signaling pathway
    447541
   04068 FoxO signaling pathway
    447541
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    447541
   04115 p53 signaling pathway
    447541
   04218 Cellular senescence
    447541
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    447541
   04530 Tight junction
    447541
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 447541
NCBI-ProteinID: NP_001087717
UniProt: Q66IZ3
LinkDB
Position
Un
AA seq 289 aa
MEGNVLRWETELKAQEEPVLLQSRVLMNLLLELEERHIPCISYFHCVQTRLQPYMRRMLT
SWMLEVCEEQKCGEDVFPLAVNCLDRFLSLVPVEKRHLQLLGSTCLFLASKLRDSTPMTA
ESLCMYSDYCFTDKELLAMELLVLNKLKWDIEAVTPRQFLPHFLELLVIPTEKRPRVRKL
AETFITLCSTDCTFITLPPSMVAAACVAAAVTGLQLQSSGMSYSSVATVTFLAHAIRCEP
SLLRTCQEQIEISLESSLQEAQRNRISESKSVEEPERSSTPTDVLDIDL
NT seq 870 nt   +upstreamnt  +downstreamnt
atggagggaaatgtgctgcgctgggagacggagctgaaggcccaggaggagccggtgctg
ctgcagagccgagtgttgatgaatctgctgctggaattagaggagagacacatcccgtgt
atttcctacttccactgtgtccagactcggctccagccctacatgcggcgcatgctcact
agctggatgctcgaggtgtgtgaagagcagaaatgcggagaagacgtcttccccctggct
gtcaactgtctggacaggttcttgtccctggtgccagtagagaagagacatctccagctt
ttgggctcaacgtgcctctttcttgcctctaaactcagggactccactcccatgactgcc
gagagcctgtgcatgtactcagactactgtttcactgacaaagaactgctggcaatggag
ctgctggtgctgaacaagctgaaatgggacatagaagcggtgacaccccgacagttcctg
ccgcacttcctcgaactgttggttatccctacggagaagaggcctcgggtcaggaagctg
gcggagaccttcatcactctgtgtagcactgactgtacatttattaccctccccccttcc
atggtggctgcagcctgtgtagccgcagcagtgaccggcctccagcttcagagttcggga
atgagctactccagcgtggctaccgtaaccttccttgcacatgccatacgctgtgagccg
agtcttctcaggacttgtcaggagcagattgaaatctcgcttgagtccagtctgcaggag
gcgcagagaaacagaatctccgagtccaagtctgtggaggagccagagagatccagcacc
ccaactgatgtcctggacattgacctgtaa

DBGET integrated database retrieval system