KEGG   Xenopus laevis (African clawed frog): 447748
Entry
447748            CDS       T01010                                 

Gene name
ccndx.L, ccndx, ccndx.S
Definition
(RefSeq) cyclin Dx L homeolog
  KO
K04503  G1/S-specific cyclin-D1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04115  p53 signaling pathway
xla04218  Cellular senescence
xla04310  Wnt signaling pathway
xla04340  Hedgehog signaling pathway
xla04371  Apelin signaling pathway
xla04510  Focal adhesion
xla04530  Tight junction
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    447748 (ccndx.L)
   04340 Hedgehog signaling pathway
    447748 (ccndx.L)
   04371 Apelin signaling pathway
    447748 (ccndx.L)
   04068 FoxO signaling pathway
    447748 (ccndx.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    447748 (ccndx.L)
   04115 p53 signaling pathway
    447748 (ccndx.L)
   04218 Cellular senescence
    447748 (ccndx.L)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    447748 (ccndx.L)
   04530 Tight junction
    447748 (ccndx.L)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 447748
NCBI-ProteinID: NP_001087887
Xenbase: XB-GENE-6077523
UniProt: Q641B3
LinkDB
Position
7L
AA seq 290 aa
MEGNLLCWEPETELRAQSDPVLLQSRVLMKLLELEERYIPSASYFYCVQTHLQPYMRRML
TSWMLEVCEDQKCGEDVFPLAVNCLDRFLSLVPVEKRRLQLLGSTCLFLASKLRETTPMT
AESLCMYSDYCFTDKELLAMELLVLNKLKWDIEAVTPREFLPHFLELLGLPTEKRRQVRK
HSETFIALCTTDCTFIALPPSMVAAASVVAAVTGLQLQSPGMSNSSVATITYLAHAIRCD
PSLLRTCQEQIEMSLESSLQQAQRNRISESKSVDEPERSSTPTDVLDIDL
NT seq 873 nt   +upstreamnt  +downstreamnt
atggagggaaatctgctgtgctgggagcccgagacagagctgagggcccagtccgacccg
gtgttgctgcagagccgagtgctgatgaagctgctggaattagaggagagatacatcccg
tctgcttcttacttctactgtgtccagactcacctgcagccctacatgcggcgcatgctc
actagctggatgctcgaggtgtgtgaagaccagaagtgcggagaagacgtgttccctctg
gctgtcaactgtctggacaggttcttgtccctggtgccagtagagaagagacgactgcag
cttctgggctcaacgtgcctctttcttgcctccaaactgagggaaaccacccccatgact
gccgagagcctgtgcatgtactccgactactgtttcactgacaaagaactgctggcaatg
gagctgctggtgctgaacaagctgaagtgggacatagaagcggtgaccccccgggagttc
ctgccgcactttttggaactgttgggtctccctacggagaagagacgtcaggtcaggaag
cactcggagaccttcattgctctgtgcaccaccgactgtacatttattgcactcccccct
tccatggtggctgcagccagtgtagtcgcagcagtgaccggcctccagcttcaaagtcca
ggaatgagcaactccagcgtggctaccataacctaccttgcacatgccatccgctgtgac
ccgagtcttctcagaacttgtcaggagcagattgaaatgtcacttgagtccagtctgcag
caggcgcagaggaacaggatctccgagtccaaatctgtggatgagccagagagatccagc
accccgactgatgtcctggacattgacttgtaa

DBGET integrated database retrieval system