KEGG   Xenopus laevis (African clawed frog): 492305
Entry
492305            CDS       T01010                                 

Gene name
cdkn1a.L, cdkn1a, cip1, p16Xic2, p21
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1A (p21, Cip1) L homeolog
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04012  ErbB signaling pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04115  p53 signaling pathway
xla04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    492305 (cdkn1a.L)
   04068 FoxO signaling pathway
    492305 (cdkn1a.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    492305 (cdkn1a.L)
   04115 p53 signaling pathway
    492305 (cdkn1a.L)
   04218 Cellular senescence
    492305 (cdkn1a.L)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 492305
NCBI-ProteinID: NP_001087933
Xenbase: XB-GENE-865738
UniProt: Q5V9L9
LinkDB
Position
2L
AA seq 138 aa
MQSALAIPKQASGNKEKSCRMLFGPVDHEQLRADFDEFMQKSNEEAKAKWNFGFATETPL
EGQYDWVKVENNTLNGSSQESQKENQCQDVATERCNISPSSKAFQNCESSDSGKRKQKLI
TDFYPVKRRCSPVPSLHD
NT seq 417 nt   +upstreamnt  +downstreamnt
atgcagtctgccttagccatccccaagcaagcatctgggaataaggaaaagtcttgcaga
atgctttttggccccgtagaccatgaacagctaagagcagactttgatgaatttatgcag
aaatccaacgaggaagcaaaagctaaatggaactttggctttgccactgaaacacccctt
gaagggcaatatgattgggtaaaggtagaaaacaacaccttgaatggcagctctcaggaa
agtcaaaaagaaaaccagtgccaagatgtagccacagagagatgtaacattagcccatcc
tctaaagcgttccagaattgtgaaagcagcgattcaggcaaacgaaaacaaaagctgatc
acagatttttatcctgtcaagcggagatgttcacccgtgcccagcctccatgattaa

DBGET integrated database retrieval system