KEGG   Xenopus laevis (African clawed frog): 492306
Entry
492306            CDS       T01010                                 

Gene name
cdkn1b.S, cdkn1b, cdkn1b.L, cdkn4, kip1, men1b, men4, p16Xic3, p27kip1
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B (p27, Kip1) S homeolog
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04012  ErbB signaling pathway
xla04068  FoxO signaling pathway
xla04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    492306 (cdkn1b.S)
   04068 FoxO signaling pathway
    492306 (cdkn1b.S)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    492306 (cdkn1b.S)
SSDB
Motif
Pfam: CDI Med20
Other DBs
NCBI-GeneID: 492306
NCBI-ProteinID: NP_001087934
Xenbase: XB-GENE-6255342
UniProt: Q5V9L8
LinkDB
Position
3S
AA seq 141 aa
MSGVPLFPEAPGVERVSRAPSSPRSPARRSLFGPVDHELLARDFERSLRAMEEEKREKWN
FDFRNYRPLPGPLQWKETDQAPEFYHRGHQHKSQRTESSPAESRAKKRSGEAAGESKCAR
GRAEPQAPLILNFTLLLLSSS
NT seq 426 nt   +upstreamnt  +downstreamnt
atgtcgggggtgccgctattcccggaggccccgggagtggaacgggtgtcccgggccccc
agttccccgcgttcccccgcccggcgcagcctgtttggtccggtagatcacgagctgttg
gcccgggactttgagcggagccttcgggcgatggaggaagagaaacgcgagaagtggaac
ttcgacttccgcaactaccggccgctaccggggccccttcagtggaaggaaacggaccag
gcgcctgaattctaccaccggggacaccagcacaaatcacagcggaccgagtcgagtccg
gccgaatcccgagcgaagaagcgcagcggagaggcagcgggtgagtccaagtgcgcccgg
gggagggcggagccacaagctcccctgatacttaacttcaccctgctgctgctgtcgtcg
tcttaa

DBGET integrated database retrieval system