KEGG   Xenopus laevis (African clawed frog): 496013
Entry
496013            CDS       T01010                                 

Gene name
rchy1.L, rchy1
Definition
(RefSeq) ring finger and CHY zinc finger domain containing 1, E3 ubiquitin protein ligase L homeolog
  KO
K10144  RING finger and CHY zinc finger domain-containing protein 1 [EC:2.3.2.27]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
xla04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:xla00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    496013 (rchy1.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    496013 (rchy1.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:xla04121]
    496013 (rchy1.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     496013 (rchy1.L)
Ubiquitin system [BR:xla04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    496013 (rchy1.L)
SSDB
Motif
Pfam: zinc_ribbon_6 zf-CHY zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-C3HC4_3 zf-RING_UBOX zf-RING_5 Prok-RING_4
Other DBs
NCBI-GeneID: 496013
NCBI-ProteinID: NP_001088749
Xenbase: XB-GENE-956539
UniProt: Q5PQ16
LinkDB
Position
1L
AA seq 248 aa
MEVTGGCEHYSRSCQLRAPCCGKFYTCRLCHDSKESHKMDRFNVTQVQCMECKCVQKAQQ
TCEQCHMVFGDYYCNICHLFDKDKKQYHCDGCGICRIGPKEEFEHCTKCNLCLPLSLRGN
HKCIENVSRQDCPICLEDIHTSRVGARVLPCGHLLHSTCYEDMLKQGYRCPLCMRSALDM
TRYWRQLDDEVAQTPMPSEYQNMTVEILCNDCSSRSTVPFHILGMKCESCSSYNTAQEGK
TLTQTARE
NT seq 747 nt   +upstreamnt  +downstreamnt
atggaggtgacgggaggctgcgaacattactcccggagctgtcaactaagggcaccttgc
tgtggaaaattttatacatgccgcctgtgccatgacagcaaagagtcacacaagatggac
cgttttaatgtcacacaagttcagtgcatggaatgtaaatgtgttcaaaaggctcagcag
acatgtgagcaatgccacatggtatttggtgattattactgcaatatatgccacttattt
gataaggacaagaagcagtatcactgtgatggatgcggcatatgcaggattggtccaaaa
gaggagttcgaacattgtacaaaatgtaatttatgtttaccactgagcctcagaggaaac
cataagtgtatagaaaatgtatcaagacaagactgtccaatatgcctagaggacatacat
acctcacgtgtaggtgcacgtgtcctgccttgtggtcatcttcttcacagtacttgttat
gaggacatgttaaaacaaggatacagatgccccttgtgtatgcgttctgctctggatatg
accaggtactggcgtcagctggatgatgaagtggctcagaccccaatgccctctgaatat
cagaatatgaccgttgagatcctatgcaatgactgcagctccagatccacagtgccgttt
cacattctcggaatgaaatgtgaaagttgtagttcatataacaccgcgcaagaagggaag
acactaacgcagacagccagggaatga

DBGET integrated database retrieval system