KEGG   Xenopus laevis (African clawed frog): 496037
Entry
496037            CDS       T01010                                 

Gene name
tgfa.L, tgfa
Definition
(RefSeq) transforming growth factor alpha L homeolog
  KO
K08774  transforming growth factor, alpha
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    496037 (tgfa.L)
   04012 ErbB signaling pathway
    496037 (tgfa.L)
SSDB
Motif
Pfam: EGF hEGF
Other DBs
NCBI-GeneID: 496037
NCBI-ProteinID: NP_001088773
Xenbase: XB-GENE-866436
UniProt: Q5PPZ2
LinkDB
Position
3L
AA seq 160 aa
MNLPTAGESMILLLGFLLAACQALENTTSQLSDPPVAAAVRSHFNDCPDSHSDFCFHGTC
RFIVQEDLPACVCQPGFVGTRCEHADLLAVVAANNKKQTITALVVVSIVATAVLIGTCML
IHCCRIRKQCQWCRAVFCQHEKPGSFLKGGVSCCKAETVV
NT seq 483 nt   +upstreamnt  +downstreamnt
atgaatctgcccaccgcgggggaaagcatgatcctgttactgggatttctgctagctgct
tgccaagccctggagaacacgaccagccagctgagtgatcctcccgtagcagctgctgtg
agatctcactttaatgattgccccgactctcacagcgatttctgcttccatggaacatgc
aggtttatagtgcaagaagatctacctgcctgcgtgtgccagccagggtttgtcggtacc
cgctgcgaacatgccgaccttttagcggtggtagcggccaataataagaagcaaacaatc
accgctctggtggtggtgtctattgttgcaacagctgtcctcattggaacttgcatgtta
atacactgctgcagaataagaaagcagtgccagtggtgccgggctgtgttctgtcagcat
gagaagcccggcagtttcttgaaaggtggggtttcctgctgcaaagctgagacagtggtc
tga

DBGET integrated database retrieval system