KEGG   Xenopus laevis (African clawed frog): 496168Help
Entry
496168            CDS       T01010                                 

Gene name
gstz1.L, gstz1
Definition
(RefSeq) glutathione S-transferase zeta 1 L homeolog
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00350  Tyrosine metabolism
xla01100  Metabolic pathways
Module
xla_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    496168 (gstz1.L)
Enzymes [BR:xla01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     496168 (gstz1.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-GeneID: 496168
NCBI-ProteinID: NP_001088856
Xenbase: XB-GENE-978913
UniProt: Q3B8M0
LinkDB All DBs
Position
8L
AA seq 216 aa AA seqDB search
MAALGKPLLYGYFRSSCTWRVRIALAFKGIEYDQQAINLVKDGGLQLSDEYKQVNPMQQV
PALHIDGVTLSQSLAIIEYLEETRPNPPLFPREPKKRAQVRMISDQIASGIQPLQNLCVL
QKIGETKQEWAKHFITRGFQALEKMLQITSGSYCVGDEVTVADLCLVPQVANAVRFKVDL
SPYPTIVRINESLLQMEAFQVSHPSRQPDTPEELRA
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctggggaagcctctcctgtatggatattttcgcagttcttgcacatggaga
gtgcggatagctctggcattcaagggcattgagtatgatcaacaagccattaatctagtc
aaggatggtggactgcagctatctgatgaatacaagcaggtgaatcccatgcagcaggtg
ccagctttgcacattgatggagtgactttgagccaatcacttgcaatcattgagtatctt
gaggaaactcgccctaacccacctctttttccacgtgagccgaagaaacgggcacaggtt
cgcatgatcagtgaccaaattgcatcagggattcagcctttgcagaatctctgtgtactg
cagaaaattggagagacaaagcaagaatgggccaagcatttcatcacacgtggctttcaa
gctttggaaaagatgctgcagatcacatctggaagttattgtgtgggagatgaggtgacc
gtagctgatctgtgtcttgttccacaggtggcaaacgctgtgaggttcaaggtcgacctt
tccccatatcccaccattgtaaggattaatgagtctctactgcagatggaagcatttcag
gttagccacccatctcgccagcctgatacgcctgaggaacttagagcataa

DBGET integrated database retrieval system