KEGG   Xenopus laevis (African clawed frog): 735069
Entry
735069            CDS       T01010                                 

Gene name
ikbkg.L, ikbkg
Definition
(RefSeq) inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma L homeolog
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04210  Apoptosis
xla04620  Toll-like receptor signaling pathway
xla04621  NOD-like receptor signaling pathway
xla04622  RIG-I-like receptor signaling pathway
xla04623  Cytosolic DNA-sensing pathway
xla04625  C-type lectin receptor signaling pathway
xla04920  Adipocytokine signaling pathway
xla05132  Salmonella infection
xla05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    735069 (ikbkg.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    735069 (ikbkg.L)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    735069 (ikbkg.L)
   04621 NOD-like receptor signaling pathway
    735069 (ikbkg.L)
   04622 RIG-I-like receptor signaling pathway
    735069 (ikbkg.L)
   04623 Cytosolic DNA-sensing pathway
    735069 (ikbkg.L)
   04625 C-type lectin receptor signaling pathway
    735069 (ikbkg.L)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    735069 (ikbkg.L)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    735069 (ikbkg.L)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    735069 (ikbkg.L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    735069 (ikbkg.L)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   735069 (ikbkg.L)
SSDB
Motif
Pfam: CC2-LZ zf_C2H2_10 NEMO DMPK_coil ZapB APG6_N
Other DBs
NCBI-GeneID: 735069
NCBI-ProteinID: NP_001089998
Xenbase: XB-GENE-979187
UniProt: Q58EW6
LinkDB
Position
Un
AA seq 495 aa
MVQPTENPATDYNLCEGVTGDTSLGKPEVLPPELTNNEAFQRIWAENHDLRGALEQSNKM
LRKGHSELLEFQESQRKEREFITYKFGEARNLVLRLTSERNSLQCQLEEAMKQAAEIQET
PEQRQSENTILTDQRLQRKAYGEQKEPVNREVCTESETLQGTVDRNHRTEQEFQKKLQEA
EARNTQFLQQIADLQEEVSKLRHQVVEKGEESQKQLQSLQAQLEQLSDERNSVKAQVTSL
LGELKESQTSLEICLQEKRKVEDSLRNTLEEKKVWEAQVKQQVVQLDQRMMQAQNLETAL
KVERQNATDEKRKLAQLQVAYHKLFQEYDTHIKLSMQQEKHTKGVDMQIQELKQQLQEAE
EALVAKQELIDKLKDEAEKQRADLDTVPVLKAQVEIYRADFLAERKAREKLHAEKERLQE
QLNELLRERAMIDEMRNRHSDTLRPTLPHGPSLYPLPSAMPFQPEVEPPDFSCPKCFYKA
PDMDTLQIHVMDCIQ
NT seq 1488 nt   +upstreamnt  +downstreamnt
atggtgcagcccactgagaaccccgccaccgactacaacctgtgtgagggggttacaggg
gacacatccctggggaaacctgaagttcttcctcctgaactgaccaataacgaagccttt
cagcggatatgggcggaaaaccatgacctcagaggtgctctagagcagagcaacaagatg
ttacgcaaaggtcacagtgagctgctggagtttcaggaatcccagagaaaggagagagag
ttcatcacgtacaagtttggcgaggctcggaacctggtgctgagacttacaagcgaacgc
aactccctgcagtgtcagctggaggaagccatgaagcaggcagcagagattcaagagact
ccagagcagaggcagtccgagaatactatattgactgaccagagacttcagaggaaagca
tatggtgaacagaaagaacctgttaacagggaagtttgtacagaaagtgaaaccctgcaa
ggaactgtggaccggaaccatagaacagagcaagaattccagaagaaactgcaagaagct
gaagccaggaatactcagttcctgcagcagattgcagacctgcaagaggaagtgtctaag
cttaggcaccaggtggttgaaaaaggggaggaatcgcaaaagcaactgcaaagcctgcaa
gcacagctggagcaactgtctgatgaaaggaattcagtgaaagcccaggtgacttctcta
ttgggggagctaaaagagagtcagacaagtctggagatctgcctgcaggaaaagagaaaa
gtggaggacagcctccgtaacaccctggaggagaagaaggtgtgggaagcacaagtgaag
caacaggttgtgcaactggaccaacgaatgatgcaagcgcagaatctggaaacggcactg
aaagtggagaggcaaaatgccacagacgagaagaggaaactggcacaacttcaggtggcc
tatcacaagctcttccaggaatacgacacacacatcaaattaagcatgcagcaggaaaag
cacaccaagggagtggacatgcagatccaggagttgaagcagcagcttcaagaggcggaa
gaagctctagttgccaaacaagaactgatagataaattaaaggacgaggcagagaagcag
agggctgatttagacaccgtaccagtgctgaaagcccaggtggagatataccgggcagac
tttctagctgagcgaaaagcacgagagaagctgcacgcagagaaggagaggctgcaggaa
cagttgaatgagctactgcgagaaagggcaatgattgatgagatgaggaacaggcactca
gataccctacgtcccaccttgccccatggcccatccctgtaccctcttccatccgccatg
cccttccaacccgaggtagaacctccagacttcagctgccccaagtgcttttacaaagca
ccagatatggacaccctacagatacacgttatggattgtatacagtaa

DBGET integrated database retrieval system