KEGG   Xiphophorus maculatus (southern platyfish): 102216606Help
Entry
102216606         CDS       T02923                                 

Gene name
lig3
Definition
(RefSeq) DNA ligase 3 isoform X1
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma03410  Base excision repair
Module
xma_M00296  BER complex
Brite
KEGG Orthology (KO) [BR:xma00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    102216606 (lig3)
Enzymes [BR:xma01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     102216606 (lig3)
DNA repair and recombination proteins [BR:xma03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     102216606 (lig3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N LIG3_BRCT zf-PARP DNA_ligase_A_C RNA_ligase BRCT_2 mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 102216606
NCBI-ProteinID: XP_014328100
Ensembl: ENSXMAG00000011457
LinkDB All DBs
Position
11
AA seq 998 aa AA seqDB search
MQRHLIFLVQKTVCVGRQPFGTLIRFKQASALCRTFPISSTSYQRKSLASHIQHLQKRHA
PWTSIHRCFSEWPDMSEQRFLVEYAKRGTAGCKKCKDKIQKGVVRIGKVVPNPFSESAGE
MKEWYHVKCIFEKLERARATTKKIEDLTELEGWEELQEEDKELINKHVSDLMAKVNASPK
KKVQAKLNTTGQLMAPPADPSVNAPRKFSGFTAAKAGSSGSSSSSSSPGLSTSPAAKAGS
GSALSTQLCDAQHKDCLFREFRKLCAMVAENNSYNSKTQIIEKFLKKGTGGDKFHGDLYL
TVKLLLPGVVKSVYNLNDKQIVKLFSRIFRSNQEDMVRDLEQGDVSETVRIFFEESKCFP
PAAKSLLTIQEVDAFLMRLAQLTKEDEQQSELESIAKKCTSNDLKCIIRLIKHDLKMSAG
AKHVLDAVDPNAYDAFKASRNLGDVIERVLRNQQDATSGSGPRKLLTVEASLMTPVQPML
AEACKSIEYAMKKCPNGMYSEIKYDGERVQVHKNGNTFSYFSRSLKPVLPHKVAHFKEYI
PQAFPGGHSMILDAEVLLIDTKTSKPLPFGTLGVHKKAAFQDAKVGLFVFDCIYFNGVSL
MERPLCERRKFLDDNMVEVPNRILFSEMKHVTRAGDLAEMITRVIREGLEGLVLKDVKGS
YEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYGKGSNGGIMSSFLMGCYDPDSKKWCT
VTKCSGGYDDAMLARLQKELDVIKISKEPGKIPSWLKIVKNYYPDFIIRDPEQAPVWEIT
GAEFSKSEMHTADGISIRFPRMTRIRDDKDWKTATNLHQLRELFRISKENCDFKVTAGPS
TSDDKGSSGGDSGGNSPSSSSSRSAPAKKTSSSTPTKPKAVKSKPRTPTSEASSAKKVKE
SVQSNGQNKASSQLLQPRNDKSLLDIFSGVKLFLPVSVQDFDRLRRYFVAYDGDLVPDYD
SASATHTLGDPEGGSRAQRVSPSWIWECIRKRRVVPPC
NT seq 2997 nt NT seq  +upstreamnt  +downstreamnt
atgcagaggcatcttattttcttggtacagaagactgtctgtgtgggccgacaacctttt
ggcacactaatccgatttaaacaagcttcagcgttgtgcagaacatttccaatttcatct
acctcttatcagcgaaaatccttagcatcccatatacaacaccttcaaaaaagacacgct
ccctggacttcaattcaccggtgcttttctgagtggccagatatgtcggaacaacgcttc
ctggtggaatacgccaaacgtggcacggcggggtgcaagaaatgcaaggacaagatccag
aagggcgtcgtgcgcatagggaaagtcgtgccaaaccctttcagcgagtctgctggcgag
atgaaagagtggtatcacgtgaagtgcatatttgagaagctggagagggcaagagccacg
acgaagaagatcgaggacctgacggagctggagggctgggaggagctgcaggaggaggac
aaagagctcattaataaacacgtttcagacctgatggccaaagtcaatgcaagtcctaaa
aagaaggtccaggccaagttgaacaccactggtcagcttatggcgccccctgctgaccct
tctgtcaatgctccgaggaagttttctggcttcacagctgcgaaggctggcagctccggc
agctccagcagctccagcagccccggactgtcgacgtccccggcggccaaagccggctcc
ggcagcgccctgtccactcagctctgcgacgcccagcacaaagactgcctcttcagggag
tttcgcaaactctgcgcaatggtggctgaaaacaacagctacaacagcaagacacagatt
atagagaagttcctgaagaagggcacaggaggagataaatttcacggagatctttacctg
acggtgaagctgctgctgccaggcgtggttaaaagtgtttacaacctgaacgataagcag
atagtaaaactcttcagccgcatattcaggtccaaccaggaggacatggtgcgagatctg
gagcagggcgacgtgtcagaaacggtgaggattttcttcgaggagagcaaatgttttcct
cccgctgccaagagcctcctaacaatccaggaagtagatgcgttcctgatgcgcctcgct
cagctcacaaaggaggacgagcagcagagcgagctggagagcatcgccaaaaaatgcacc
agcaacgacctgaaatgcatcatcaggctaattaagcacgacttgaagatgagcgctggc
gccaaacacgtgttggacgcggtagatccaaacgcgtacgacgccttcaaggcctcccgt
aaccttggcgacgtgatcgagagggttctgaggaaccagcaggatgccaccagcggctct
ggacccaggaagctcctgaccgtggaggcgtcgctcatgacgcccgtccagccgatgctg
gccgaggcgtgtaaatccatcgagtacgccatgaagaaatgtcccaacgggatgtactcg
gagataaaatacgacggcgagcgcgttcaggtccacaagaacggaaacaccttcagctac
ttcagccgcagcctcaagccggtgctgccccacaaggtggcccatttcaaagagtacatc
cctcaggccttccctggcggccacagcatgattctggacgctgaagtcctgctgattgac
acaaagaccagcaaaccgctgccgtttggcactctgggtgttcacaagaaagctgccttt
caagacgccaaagtgggtctgtttgtgttcgactgcatttacttcaacggtgtgagtttg
atggaaaggccgctctgcgaacgcaggaagttcctggacgacaacatggtggaagtccca
aacaggatcctcttctcagagatgaagcacgtcacgagggcaggagacctggcggagatg
ataactcgcgtcatcagagaaggactggaaggcctggtgctgaaagacgtaaagggaagc
tatgagccggggaagcgacactggctgaaggtgaagaaggattatttgaacgagggagcg
atggccgacacagcagacctggtggtgctcggtgccttctacggaaaaggatcaaacggg
ggcatcatgtctagctttctgatgggctgctacgacccggactcgaagaagtggtgcacg
gtgaccaagtgctccggaggatacgatgacgccatgctggcccgactccagaaggagctg
gatgtgatcaaaatcagcaaggaacccgggaaaattcccagctggttgaaaattgtcaag
aactattatcctgatttcattatccgtgaccctgagcaagcgccagtctgggagatcacc
ggcgcagagttttccaaatcagaaatgcacaccgccgacggcatctccatccgcttcccc
cgcatgacgcgaatccgcgacgacaaggactggaagacggccaccaacctgcaccagctc
agggagctgtttcgcatttcgaaggagaactgcgactttaaagtgacggcgggtccttcc
acgtccgacgacaaaggctcatcgggaggagacagcgggggaaactcgccgtcgtcctca
tccagcaggagcgctccggccaaaaagacgagtagcagcacccctaccaaaccaaaggct
gtaaaatcaaaaccccgcactcccacctctgaggcctccagcgccaagaaggtgaaggag
agcgttcagagcaacggacaaaacaaagcgtcttcccagctgctgcagccgaggaacgac
aagtcgctgctggacatcttcagcggggtcaagctcttcctccccgtctccgttcaggac
ttcgacagactgcggcggtactttgtggcgtacgacggggacctggtgccggattacgac
tccgcctcggctacacacacgctgggcgacccggaggggggcagccgggcccagagggtc
tctcccagctggatctgggaatgcatccgaaagcggcgcgtcgttcctccctgctga

DBGET integrated database retrieval system