KEGG   Xiphophorus maculatus (southern platyfish): 102216735Help
Entry
102216735         CDS       T02923                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00010  Glycolysis / Gluconeogenesis
xma00030  Pentose phosphate pathway
xma00051  Fructose and mannose metabolism
xma00052  Galactose metabolism
xma01100  Metabolic pathways
xma01200  Carbon metabolism
xma01230  Biosynthesis of amino acids
xma03018  RNA degradation
Module
xma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102216735
   00030 Pentose phosphate pathway
    102216735
   00051 Fructose and mannose metabolism
    102216735
   00052 Galactose metabolism
    102216735
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    102216735
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:xma01009]
    102216735
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:xma03019]
    102216735
Enzymes [BR:xma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     102216735
Protein phosphatases and associated proteins [BR:xma01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102216735
Messenger RNA biogenesis [BR:xma03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     102216735
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 102216735
NCBI-ProteinID: XP_005796641
Ensembl: ENSXMAG00000006421
UniProt: M3ZWA5
LinkDB All DBs
Position
6
AA seq 793 aa AA seqDB search
MAGATGPKRQDTRKFFENLSGAGKCIAVLTSGGDAQGMNGAVRAVVRMGIYVGAKVYFIH
EGYQGMVDGGDYIKEATWESVSSVLQVGGTVIGSARCKEFRSHEGRLKAAHNLVQRGITY
LCVIGGDGSLTGANLFREEWSGLLNELIQQGLIDEEAARSHSHLHIVGMVGSIDNDFCGT
DMTIGTDSALHRIIEVVDAIMTTAGSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPE
MPPEDGWEDNMCQKLSENRADKKRLNIIIVAEGAIDCHNKAITPDYIKDLVVSCLGFDTR
VTILGHVQRGGTPSAFDRILASRMGVEAVLALLEASTDTPACVVSLVGNQAVRLPLMECV
QMTQEVQKAMDEKKFDEAVRLRGRSFENNLSTYRLLASQTARSELQNSSFNVAVMNVGAP
AAGMNAAVRSAVRVGITEGHKMFAVNDGFEGFYKGQIKEIKWGDVGGWTGQGGSLLGTKR
TLPAKHLDAIAEQMRIHNITALLVIGGFEAYVGLLELSSARDKYAEFCVPMVMIPATVSN
NIPGSDLSIGSDTALNAITDTCDRIKQSASGTKRRVFIIETMGGYCGYLATVGGLAAGAD
TVYIYEEPFDIRDLQANVEHLTQKMKTSIQRGLVLRNENCNENFTTDFIYQLYSEEGRGV
FDCRKNILGHMQQGGAPSPFDRNFGTKVAAKAIQWITRALKESYKEGKVFTNSEDTACLL
GMRRRAMVFQPVAQLREETDFVHRIPKEQWWLKLRPLMKILAKYKTSYDVSDAGQLEHVT
RVRPKENDASAAI
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atggccggagcgacgggaccgaagcggcaggacacccggaaatttttcgagaatctttct
ggagctgggaaatgcatcgccgtgctgaccagcggcggagatgctcaaggcatgaatgga
gctgtccgggctgtggtccgaatggggatttatgtgggagccaaagtctactttattcac
gaggggtatcaggggatggtagacggtggagactacatcaaagaggcgacgtgggaaagt
gtctccagcgttctgcaagtgggtggcactgtcatcggcagtgctcgttgtaaagagttt
cgctcccatgagggcagactaaaagctgctcacaacctcgttcagaggggcatcacttac
ctgtgtgtgattggtggagacggcagcttgaccggagccaacctgttcagagaagagtgg
agtggccttttgaatgaactcatacagcaagggctcatagatgaagaggcagccagaagt
cattctcatcttcacattgtcggtatggttggctctatcgacaacgacttctgtggcaca
gacatgaccattggcactgactcagccttgcatcggatcattgaggtggtggatgctatc
atgactacagctgggagtcaccagaggacatttgtgctggaagtcatgggcagacactgc
ggataccttgccttagtcagtgccctcgcatgtggagcagattgggtttttattccagag
atgcctcctgaggatggctgggaagacaacatgtgtcagaaactgtctgagaaccgtgct
gataagaaaaggctgaacattattattgtagctgagggtgccattgattgccacaacaag
gcaataacccctgattatatcaaggacctggtagtgagctgcctgggttttgacaccagg
gtcactatcttgggccacgtacagagaggtgggactccatctgcctttgacaggattttg
gccagtcgaatgggcgtggaggcagtgttggcattactggaggcgtccaccgacacacct
gcctgtgttgtgtctctagttggcaaccaggctgttcgactaccgcttatggagtgtgtt
cagatgactcaagaggtacagaaggccatggacgagaagaaatttgatgaggcggtcaga
ctgcgcggcaggagctttgaaaataatctgagcacctacagactgcttgcttctcaaact
gctcgctctgaactccaaaatagctcctttaacgtggcggtgatgaacgtcggcgctccg
gctgccggtatgaatgccgccgtgcgttctgccgtcagggtgggaatcacagaaggccac
aaaatgtttgctgtcaacgacggctttgagggcttctacaaaggacagatcaaggagata
aaatggggagatgttggaggttggactggccaaggaggatctctgctgggaacaaaaaga
actcttccagcaaaacatctggatgcaattgctgagcagatgaggatccataacatcact
gctttacttgttatagggggatttgaggcatacgttggattactggaactctcctcggca
cgggacaaatacgccgagttctgcgtgcccatggttatgatcccagccacagtctccaat
aacatacctggttcagatctcagcattggctcagacacagctctgaatgccattactgac
acatgcgatcgcatcaagcagtctgccagcggcaccaagcggcgggtcttcatcattgag
acgatggggggctactgcggctacttggccacggtgggcggtctggctgcaggagccgac
acggtctacatctacgaggagccgtttgacatccgtgacctgcaggccaacgtggagcat
ctgacgcagaaaatgaagacgagcatccagagaggcttggtgctccgaaatgagaattgc
aacgaaaacttcaccactgatttcatctaccagctgtactctgaagaaggtcgaggcgtg
tttgactgcaggaagaacatcctgggtcacatgcagcagggcggcgctccgtctcccttc
gacagaaactttggcaccaaggttgcagctaaagccatacagtggatcacacgggcactc
aaggagtcatacaaagaagggaaagtgttcaccaactcagaggacaccgcctgcctgctg
gggatgcgccgaagggcgatggtctttcaacctgtagctcaactcagggaagagaccgac
tttgtccaccggatcccgaaggagcagtggtggctcaagctccgtcccttgatgaaaatc
ctggccaagtacaagacgagttacgacgtgtcggacgccggccagctggaacacgtgacc
cgggtgcggcccaaagagaacgacgcctcggccgcgatctga

DBGET integrated database retrieval system