KEGG   Xiphophorus maculatus (southern platyfish): 102216935Help
Entry
102216935         CDS       T02923                                 

Gene name
si
Definition
(RefSeq) sucrase-isomaltase, intestinal
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00052  Galactose metabolism
xma00500  Starch and sucrose metabolism
xma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102216935 (si)
   00500 Starch and sucrose metabolism
    102216935 (si)
Enzymes [BR:xma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     102216935 (si)
    3.2.1.20  alpha-glucosidase
     102216935 (si)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 102216935
NCBI-ProteinID: XP_005805998
Ensembl: ENSXMAG00000017226
LinkDB All DBs
Position
18
AA seq 1824 aa AA seqDB search
MQRRGKMGKKRWTTAEIILTILFILMTILAVTMIALFVTKEPDVISEDTPNRFMPECPNI
PMAERVDCYPDAGASKAGCEQRGCCWNPLDERNVPWCFFPTNHGYIMHSFQTPQPTVFFA
EMKRMDSPSLFGGDIQDLTLHAEMQTNNRLHFKIYDSKSQRFEVPHEHIPTVTNSASSPI
SDTLEIRNNPFGLIVRRKENKKVLFDTTMAPLVFADQYLQLSAKLPSHNIYGLGEHVHQR
YRHDTNWRTWPIFTRDGFPNGGTHNLYGHYPFFLCLEDESGKSFGVFLLNSNAMEVTLQP
APAVTYRTIGGILDFYILFGDTPEDVVHEFLELTGMPVIPAYWSLGFQLSRWNYGSLDEV
KTTVERNRAIDLPYDVQYTDIDYMEEKKDFTYDKVNFSELPGFADYLHEKGQKYILILDP
AVATSKRVGGAPYEAYDRGTEKSAWVFESDGKTPLVGEVWPGETVFPDYTSPNCIEWWID
EYVRFSKEVKHDALWIDMNEVSNFLKGSNKGCADNSLNYPPYTPKILDEVMYSKTLCMDA
KQVWGNHYDVHSLYGYSMVLATEKALKQVFGSNRTLMLTRSSFPGVGKYSGHWLGDNGAN
WNDIKWAIPGMLEFGLFGIPYIGADICGFFEDSSEELCRRWMQVGAFYPFSRNHNAEGYV
PQDPAFYGADSVLVKSSKHYLKIRYTLLPYLYTLFYKAHTTGETVVRPLMHEFYSDSATW
DVDRQFLWGKHLLITPVLDPGLDRVSAYIPDAVWYDYETMERVGDRKTPVEMYLPADKLG
LHIRGGAILPTQEPDVTTTHSRRNPMGLIVALDDNNQAAGELFWDDGESRETVENGNYIH
YQFSFDNGRLNLQVTKAGYKDPNNLKFDNITIMGVPSLPSSVSVTHIPSGLITQLPNSTF
YHDEVKQVLFLSKLDLSLGESYIVEWEMINEELHRFDCYPEEGADEAKCKARGCLWKESN
NAEVPWCYYPSDYGYTVTTTSETSTGMTLDITRNMKYRSSGRPDSPDANNLRVQIWYHTS
DMLQFKIWDPTTERFEVPVPLSVPSTPEADENKRLYKVSVTQNPFGIQVVRKSTGTKIWD
SAVPGFTFSDLFIQVSTQLSSNFVYGFGETEHTTYKHDLNYHTWGMFAKDQPPGYKMNCY
GVHPFYMGLENTADAHGVLLLNSNAMDVTFQPTPALTYRTVGGILDFYMVLGPTPEMVVQ
EYTALIGRPVLPAYWSLGFQLCRYGYANDSEIAELYSDMKAAGIPYDVQYADIDYMERQL
DFVVDSQFEGLPRLVDKMRGEGMRFIFILDPAISGNETDYKAFSRGIEADVFIKWPSHLS
KEIVWGKVWPDYPNVIVDEGLDWDTQVELYRAFTAFPDFFRTQTAAWWKQEIKDFYDEMK
FDGLWIDMNEPASFVHGTVGGNCLGNPLLENPPYMPPLESKHMGLKHKTLCMNSEQILSN
GKAVSHYDVHNLYGWSHTKPTFDALLEVTGKRGIVVTRSTYPTSGKWAGHWLGDNNSSWD
QLYKSIIGMMEFSLFGISYTGADICGFFNKAEYEMCLRWMQLGAFYPYSRNHNGKGNPRQ
DPVAWDDRFTEASRDVLNIRYTLLPYLYLLMFEAHTKGSTVVRPVLHEFVKDKATWDIHK
QFLWGPALLITPALDPGVTVVEGYLPDARWYDYHTARDVGKRATKLSMDTPLEHINLHVR
GGYILPWQKPENNTFYSRKNPMGLIVALSDSGTAEGSVFWDDGEGIDTVGKNQYLLTSLT
AEEKTLSSKVVHNALDPADHLNLGVVRVWGAGTVQITGATLTDKDGGTHSLNVEHDTNTE
ELTIDATSQAVPLHYTFSITWKTG
NT seq 5475 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaggagaggcaagatggggaaaaagcgatggaccactgcagaaatcatccttacg
attctgtttatcctgatgaccatattggccgtgactatgatcgctctttttgtcaccaaa
gaacctgatgtcatttcagaggacacgccaaatagatttatgcctgagtgtcccaacatt
cctatggctgaaagagtcgactgttatcctgatgctggagcctcaaaggcgggatgtgag
cagcgtggttgttgctggaatcctctggatgagcgaaacgttccctggtgtttcttccca
accaaccatggatacataatgcactcattccaaaccccacagcctactgtgttttttgca
gaaatgaagagaatggattctccatccttgtttggtggagacatacaggacctgacactg
catgcagagatgcagacaaacaatcgacttcattttaagatctatgattccaaaagccag
agattcgaggtccctcatgagcacatccctacagtcacaaacagcgcctccagccctatc
agcgacacactcgagatcagaaacaacccctttggcctgattgtgcgcagaaaggagaac
aagaaagtcctgtttgacaccacaatggctccgcttgtttttgcggaccagtacctacag
ctgtctgctaagctcccatctcacaacatctatggcctgggtgagcatgtgcatcaaaga
tatcgccatgacacaaactggagaacttggcccattttcaccagagatggattccctaat
gggggaacacacaacctctatggacactatcccttcttcctctgtctggaagatgagagt
ggaaagtcatttggggtctttctgctcaacagcaatgccatggaggtgactttgcagcct
gccccagcagtgacctacaggaccatcggaggaatccttgacttctacattttgtttggc
gacacaccagaagatgtggtgcatgaattccttgagctcactgggatgcctgtcattcct
gcctattggtccctgggcttccagctttcacggtggaactacgggagcctcgatgaagtc
aagaccacagtggagaggaatcgtgccattgaccttccatatgacgttcaatacacagac
atagactacatggaagagaagaaagatttcacctatgacaaagtgaacttctcagagctt
cctgggtttgctgactacctccatgagaaggggcagaagtacatcctcatcctggaccct
gcagtagccaccagcaaaagggtggggggtgctccatatgaggcgtatgaccgtggtact
gaaaagagtgcttgggtctttgaatcagatggaaaaactccacttgtaggagaggtttgg
ccaggggagacggtatttccggactacaccagtccaaattgcattgaatggtggatagat
gagtatgtgcggttctccaaggaggtcaaacatgatgccctctggattgatatgaatgaa
gtgtctaacttcttgaaaggatcaaataaaggctgtgctgacaacagcctcaactaccct
ccctacactccaaagattctggatgaggtgatgtacagtaagaccctctgcatggatgcc
aagcaggtgtgggggaaccactatgatgtccacagtctgtatggctactctatggtgctg
gccactgaaaaagctctgaagcaagtgttcgggtcaaaccgtaccctgatgctgacacgc
tcctccttcccaggtgtgggaaaatattcaggacattggctgggtgacaatggtgctaac
tggaatgacataaaatgggctattcctggcatgctggagtttgggctttttggaattccc
tacatcggagctgacatctgtggattctttgaagattcaagtgaagagttgtgccgtcgc
tggatgcaagttggcgctttctatcctttcagtcggaaccacaatgctgagggctacgtg
ccccaggatcccgctttttacggtgccgactcagtgctggtgaagagctccaaacattac
ctgaagatacgttacactctcctgccttacctctacactctcttctacaaagcccacacc
acaggggagaccgttgtacgtcctcttatgcacgagttctactctgacagcgccacctgg
gatgtggatcgccagtttctttggggaaaacacctgctcatcacacctgtgcttgatccg
ggtctggacagagtctcggcatatattccagatgctgtgtggtacgactatgaaacgatg
gagcgggtgggagaccgcaaaacgcctgttgaaatgtatctacctgctgacaagcttggc
ttgcacatcagaggaggcgctattcttcctacgcaggaacctgatgtcaccacaacacac
agtcgccgtaacccaatgggtctgattgttgctcttgatgacaacaatcaagcagctggg
gagttattctgggatgatggagaatcccgagaaactgttgaaaatggcaattacatccac
taccagttctcttttgataatggacgcctgaatttacaggtgaccaaggcgggctacaag
gatccaaataatcttaaatttgataacatcactatcatgggagtgcctagtcttccctca
tcagtcagtgtgactcacatcccctctggcttaattacacaacttccaaactccacattt
taccatgatgaagtcaaacaggtgcttttcctgtccaagctggacctgagcctgggagaa
agctacatagttgagtgggagatgataaacgaagagcttcatcgttttgactgctatcca
gaggagggtgcagatgaagccaagtgcaaggccaggggctgcctgtggaaagaaagtaac
aatgctgaggtaccttggtgttactatccaagtgactacggttacactgttacaacaacc
agtgaaaccagtactggtatgacactggatatcactcggaacatgaagtacaggagcagt
ggtcgtccagactcaccagacgcgaacaacctccgtgtccagatttggtatcataccagc
gacatgctccagttcaagatttgggacccaacaacagaacgctttgaagtaccagtgcca
ctgtcagttccttcaactcctgaggcggatgaaaacaaaaggctttataaggtctcagtg
actcaaaacccgttcggcatccaggttgtaagaaagagcacaggaaccaagatctgggac
tctgccgtaccaggttttaccttctcagacttgttcatccaagtgtcgactcaactgtca
tcaaattttgtctatggttttggagaaactgagcataccacctataaacatgatcttaac
tatcatacctgggggatgttcgccaaggaccagcctcctggttacaagatgaattgttat
ggagtgcatcccttctacatgggccttgagaacactgctgatgctcacggagtgctgttg
ctgaacagtaatgcaatggatgtgactttccagccaactccggctctgacctaccgcaca
gttggaggcattttggatttctacatggtcctgggaccaacacctgagatggttgtgcag
gaatacaccgcactaattggacgacctgttctacctgcctactggtcccttgggtttcag
ctgtgtcgctacggttatgccaatgactcagaaatagcagagctatacagtgacatgaag
gcagctggtattccctatgacgtgcaatacgcagacatcgattatatggaacgtcagcta
gactttgttgtggactcacagtttgaaggactgccacgcctggtggacaaaatgagagga
gaaggcatgaggttcatcttcattctggatccagccatttcaggcaatgaaacagattac
aaagctttcagcagaggaatagaagctgatgtattcatcaaatggcccagtcatctgagc
aaagaaattgtgtggggaaaggtctggcctgattacccaaatgtcatagttgatgaaggt
cttgactgggacacccaagttgagttgtaccgggcgttcaccgcattcccagacttcttc
cgtactcaaaccgcagcatggtggaaacaagaaatcaaagacttctatgatgagatgaag
tttgatggtctttggattgacatgaatgaacctgcaagttttgtccatggcacagttggt
ggtaactgtcttggtaatcccctcctagaaaaccctccatatatgccacccctggaatcc
aaacatatgggcttaaaacacaagactctttgcatgaacagtgagcagatacttagcaat
ggaaaggcagtcagtcactatgacgtccacaacctctatggatggtctcacaccaaacct
accttcgatgctttgctggaagtcactggtaagagaggaatcgttgtgactagatcaacc
tatccaactagtgggaagtgggcaggacattggcttggagacaacaactctagctgggac
cagctgtacaaatccatcataggcatgatggaattcagtctgtttggcatttcttatact
ggtgcagacatatgtgggttctttaacaaagctgagtatgagatgtgtcttcgttggatg
cagctgggtgctttctatccttactcacgtaaccacaacggcaagggcaacccgagacaa
gaccctgttgcctgggatgacagattcactgaggcgtcccgagatgttttgaatatccgt
tacaccctcctgccttacctgtacctgctgatgtttgaggctcacaccaaaggaagcaca
gttgtcagaccagtactgcatgagtttgtaaaagacaaagctacatgggacatccacaaa
cagttcctctggggacctgccctcctcatcacccctgctctagacccaggagttacagtg
gtagaaggctatcttccagacgcacgctggtatgactaccacacagccagggatgtcggt
aagcgtgccacaaaactctccatggacacaccactggagcacattaacctccatgtcaga
ggcggatacatcctaccttggcagaaaccagagaacaacacattctacagtcggaagaat
cctatgggactcatcgttgccctgagtgactctggaactgctgaaggatctgtcttctgg
gacgacggcgaaggaatagacacagttggaaaaaaccaatatctcctaacctcccttacg
gcagaagagaaaacgttgtctagtaaggttgttcacaacgctctagaccctgctgatcat
ctgaacctgggagtggtgagggtttggggggcaggcactgtccagatcaccggggcgacg
ctgacagacaaggatggcgggacgcattcgctaaatgtagagcatgacaccaacactgag
gagctgactattgatgctacatcgcaggctgttcctctgcactatactttcagtataaca
tggaagaccggctga

DBGET integrated database retrieval system