KEGG   Xiphophorus maculatus (southern platyfish): 102217141
Entry
102217141         CDS       T02923                                 

Definition
(RefSeq) putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04010  MAPK signaling pathway
xma04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xma00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102217141
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102217141
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:xma04052]
    102217141
   00536 Glycosaminoglycan binding proteins [BR:xma00536]
    102217141
Cytokines and growth factors [BR:xma04052]
 Growth factors
  Growth factors (RTK binding)
   102217141
Glycosaminoglycan binding proteins [BR:xma00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   102217141
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 102217141
NCBI-ProteinID: XP_005795549
Ensembl: ENSXMAG00000009180
UniProt: A0A3B5QQ53
LinkDB
Position
23
AA seq 158 aa
MMADEDAFAAEERAFDGGPTLRDYRRSTRLYCMNGGYHLQILADGTVRGERDERDDHTVL
KLKAVGRGVVVIRGTAAERYLAMSAEGRLYGSSTVTEECYFVENLEENYYNTYKSQKYQD
SSWYVGLKKNGRTKLGPRTHIGQKAIFFIPRQLEDSWD
NT seq 477 nt   +upstreamnt  +downstreamnt
atgatggcggatgaagacgcgttcgcggccgaagagcgagcttttgacggcggccccacg
ctgcgcgactaccggcggtcgacgcggctgtactgcatgaacggcggataccacctccag
atcctggccgatgggacggtgcggggcgagcgggatgagcgggatgatcacactgtgctg
aagctcaaggccgtgggcagaggcgtcgtcgtcatccggggaacggcggcagagcgatat
ctggccatgagcgccgaaggccgtctgtacggctcatccacagtaacagaggagtgctac
ttcgtggagaacctagaggagaactactacaacacgtacaagtctcagaaataccaggac
agcagctggtacgtcggcctgaagaagaacggcagaactaaactaggcccaagaacccac
atcggacagaaggccatcttcttcatccccagacagctggaggattcctgggattag

DBGET integrated database retrieval system