KEGG   Xiphophorus maculatus (southern platyfish): 102217462Help
Entry
102217462         CDS       T02923                                 

Gene name
galnt17
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 17 isoform X1
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00512  Mucin type O-glycan biosynthesis
xma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    102217462 (galnt17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:xma01003]
    102217462 (galnt17)
Enzymes [BR:xma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     102217462 (galnt17)
Glycosyltransferases [BR:xma01003]
 O-Glycan biosynthesis
  Mucin-type
   102217462 (galnt17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin RicinB_lectin_2
Motif
Other DBs
NCBI-GeneID: 102217462
NCBI-ProteinID: XP_014328929
Ensembl: ENSXMAG00000013214
UniProt: M4AFN3
LinkDB All DBs
Position
18
AA seq 635 aa AA seqDB search
MQPKITPESDSNAADKSSSHRRTAGSGCSSFPAAFRPADVTRRWRVLLLLNVLAVAGFMT
FWAKCNTRSVQAVGPEAPADGRRPRANGTAQGPSVSHEVLLKRLSSLEDVVYRQLNGLSK
SLGLIEGFGGRGKGGLPATLSPLEENDAKYLKEKYGYNAYLSDRISLDRTIPDHRPNKCR
KVSYPRDLPQISLIFIFVNEALSVILRSVHSAVNHTPAHLLKEIILVDDNSDDEQLKGPL
EDYVNKRYPGLVKIVRNQKREGLIRARIEGWKVATAEVTGFFDAHVEFTPSWAEPVLARI
KEDHKRIILPSIDNIKHDTFEVERYENSGHGYNWELWCMYINPPKQWWDEGDMSAPIRTP
AMIGCSFVANRDYFGELGLLDSGMDVYGGENIELGIRVWLCGGSMEVLPCSRVAHIARMK
KPYHSNIAFHTRRNALRVAEVWMDEYKSNVYLAWNIPMENHGIDYGDVSQRVALRKNLQC
KSFQWYLDNVYPEMRRYNNTVFYGEIRNSKVSHLCMDQGMKENHTATLHPCHGWGPQLGR
YTKEGQLFLGPLGSTGDDTRCVVDDQISSFPQLLNCDKVTNAKQKTWSFSQNDSIVNRAT
GRCLEVVPANVYFGHLLVLQPCSGQRWTIKNAMKQ
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgcagcctaaaataaccccggagtcggacagcaacgcggcggataaatcgtcttctcat
cggcgcactgctggttctggttgctcaagcttccctgcggctttccgtccagctgatgtt
acccgaagatggagggtgttactgctgctcaacgtgctggcggtcgcagggttcatgacc
ttctgggccaagtgcaacacccgcagcgtgcaggcggtcggtccggaggctccggctgac
gggaggcggccccgggccaacgggacggcgcaggggcccagcgtgagccacgaggtgctg
ctgaagaggctcagctcgctggaggatgtggtgtaccggcagctaaacggtctgtccaag
tccctgggcctgatcgagggcttcggcggccgcgggaaaggcggcctgcccgccacgctt
tccccgctggaggagaacgacgccaagtacctgaaggagaagtacggctacaacgcctac
ctgagcgacaggatctctctggaccggaccatcccggaccaccggcccaacaaatgtaga
aaagtcagctacccccgagacctccctcagatctccctcatcttcatcttcgtcaacgag
gcgctgtcggtcatcctgcgctccgtccactcggccgtcaatcacacgccggctcacctg
ctcaaagagatcatcctggtggacgacaacagcgacgacgagcagctgaagggaccgctg
gaggattacgtgaacaagcgctaccctgggctggtcaagatcgtcagaaaccagaagaga
gaaggactgatccgggccagaatcgagggctggaaggtggcgacggcggaagttaccggg
ttctttgatgcccatgtggagtttactccgtcatgggccgagccggtgttggccagaata
aaagaggaccataagaggatcatcctgccgtccatcgacaacatcaagcacgacaccttc
gaggtggagcgctacgagaactcgggccacggctacaactgggaactgtggtgcatgtac
atcaacccgcccaagcagtggtgggacgagggggacatgtccgcacccatcaggactcct
gccatgatcggctgctccttcgtggccaaccgggactactttggggaactcggcctgctg
gactcgggcatggacgtctacggaggggagaacatcgagctgggcatcagggtttggctc
tgcggcgggagcatggaggtgctgccttgctccagagtggctcacatcgctcgaatgaag
aaaccttaccacagcaacatcgcgttccacacccggcgcaacgctctgcgtgtggcagag
gtctggatggacgaatacaaatccaacgtttacctggcctggaacatccccatggagaac
cacggcatcgactatggcgacgtttctcagagggtcgcgctgaggaagaatctgcagtgt
aagagcttccagtggtacctggacaacgtttacccggaaatgaggaggtacaataacacg
gtgttctacggtgagatccgtaactccaaagtgagccacctgtgtatggatcagggtatg
aaggaaaaccacacagccacccttcacccctgccatggctggggtcctcagttgggacgc
tacaccaaagagggtcagctgttcctgggtccgctgggcagcaccggagacgacacgcgc
tgcgtggtggacgaccagatcagcagctttccccaactcctgaactgtgacaaggtgacc
aacgccaagcagaagacgtggagcttctcccagaacgactccatcgtaaaccgggccacg
ggtcgctgtctggaggtggtgccggccaacgtttactttggccacctgctggtcctgcag
ccctgctcgggtcagaggtggaccatcaagaacgctatgaagcaatag

DBGET integrated database retrieval system