KEGG   Xiphophorus maculatus (southern platyfish): 102217478
Entry
102217478         CDS       T02923                                 

Definition
(RefSeq) kit ligand-like
  KO
K05461  KIT ligand
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04010  MAPK signaling pathway
xma04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:xma00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102217478
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102217478
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:xma04052]
    102217478
Cytokines and growth factors [BR:xma04052]
 Growth factors
  Growth factors (RTK binding)
   102217478
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 102217478
NCBI-ProteinID: XP_005814881
UniProt: M4AWF6
LinkDB
Position
2
AA seq 270 aa
MKKSKSWIDVCVHFLLFMTLGVHSAATGKVVNDIDRRVPDLRQNIPKDYKIPIKFIPKET
GDMCWAKLNLYYLEESLKDLSEKFGNISSNKLNIQILIQFIEEKRIGISNMNPQMLEFEC
HYRVDKWETGKYFNFVEEVCNTADRERPEEECDPPPCPTTPIPTEESSSVQSTSGHDMSY
NIATKDITRSSASSPSPLRQVVEKSLFSLLFVPLLALIFLLVWKVRSRRNVQHPRSNRGE
EEGFTEPHLMAPRQDGETSEKNALNLPAEV
NT seq 813 nt   +upstreamnt  +downstreamnt
atgaagaagtcaaaaagttggatagacgtctgtgtccatttcctgctgttcatgacgctt
ggggtacattcagctgcaactggaaaagtggtcaatgatattgacagaagagtccctgat
ttgagacaaaatattccaaaagattacaaaatccccatcaagttcattcccaaagaaacg
ggcgacatgtgttgggcaaagttaaacctttactacttggaggagagcttgaaggattta
tctgaaaagtttggaaacatttcatctaataagctcaacatacaaatactcatccaattc
attgaagagaagcggataggaatcagtaatatgaatccacaaatgttagagtttgagtgc
cactacagagtggataagtgggaaacagggaaatactttaactttgtcgaggaggtgtgt
aacaccgcagacagagaaagacctgaagaggaatgtgatccacctccctgtcccaccaca
ccgataccaacagaagaatcctcttcagttcagtccacgtcaggccatgacatgtcatac
aatatcgctactaaagacataacacgctcatcagcttcttcgccaagtccccttcgccag
gtggtggagaaaagccttttctccttactgtttgtcccactgctggccctaatcttcctg
cttgtgtggaaggtcaggtcaagaaggaacgtacagcatcctcggtcaaatcgtggagaa
gaagaaggctttacagaaccacatctgatggcacctcggcaggacggtgaaacgtcagaa
aaaaatgcgctgaacctccccgcagaagtgtaa

DBGET integrated database retrieval system