KEGG   Xiphophorus maculatus (southern platyfish): 102218222Help
Entry
102218222         CDS       T02923                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase E-like
  KO
K05622  transglutaminase 5 [EC:2.3.2.13]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
KEGG Orthology (KO) [BR:xma00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102218222
Enzymes [BR:xma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102218222
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 102218222
NCBI-ProteinID: XP_023180344
Ensembl: ENSXMAG00000009135
LinkDB All DBs
Position
20
AA seq 723 aa AA seqDB search
MSLNRPADYSSVFRSVDLHSNTNNNEHHTSEISVTELIVRRGQAFKLTLKLTQPFNLGFD
QLIMTVGTGNDPSEDLGTKSRFGVPGRSLHSASAKAVWKAEVQRTSSPETGVLVLIISPP
ADAPIGEYTLSASLKDKEKILANFSVLFNPWSSDDWVFLPKEEERREYVLNEQGIIYRGS
GDYISPMSWDFGQFEEGMVKICMMILDRNIKHWLNPADDVSARCNPIYVSRVVSAMVNSS
DDGGVVMGNWGNDYSGGLPPTHWSGSYAILKQWYNSYYRSVRYGQCWVFAGVMCSVMRLL
GIPCRVVTNFQSAHDTNKNLTIDNYFNYNGAMERESTDSIWNFHVWVEGWMRRPDLAKDG
KYDGWQVVDPTPQEKSEGLFCCGPASVTAIRNGEIDLKYDIPFVFAEVNADSVSWLVRSD
GSRTKIFSDTKTVGQYISTKAVGSYKRTDITDTYKYREGTVEERKVFAYALDKIVNGSTM
LRDAAGSPDRVSGPASSMSTVPPPDPSQPQLLIRFEEVSKPENGKDVNMKMILSSDSSTT
RTFSVNISVQAMKYTGQPEGNIQTEVTEQKLLPKKDLIVPIKVPFSVYHKYMIQRRTMSI
SAVITDLQNKDNVYLATDRVVLINPPLSITVSKESKVNQELTAEMVFMNPIDETLMDCTM
SLSGSGLMIGEEITNLPNLQPNCRFRVTVVLVPYKSGERSLLVNFSCSSFRDIKSSCIVN
IKP
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgagtctcaacaggcctgctgactacagctcagtttttagatcagtggacctccacagt
aacaccaacaacaatgagcatcacaccagtgagatctcggtgacggagctgatcgtcaga
cgaggccaagccttcaaactcaccctcaaactgactcaaccgttcaacctcggctttgat
cagctcatcatgactgtggggacaggaaatgatccatcggaggatctggggacgaagtct
cgcttcggcgtcccgggccggtcgctgcattcagcttcagccaaggcggtgtggaaggca
gaggttcaacggacctcttctcctgagaccggagtcttggttctgatcatctcaccgcca
gctgacgctcccatcggcgaatacactctgtctgccagcctcaaggacaaggaaaagatt
ttggcaaacttttctgtcctcttcaacccgtggagttctgatgactgggtgtttctgccc
aaggaggaggagaggcgggagtatgtgctgaacgaacagggcatcatctacagaggaagc
ggagattacatctctccaatgtcctgggactttgggcagtttgaggaaggcatggtgaag
atctgcatgatgattctcgaccgcaacatcaaacactggcttaatccagctgatgacgtt
tctgctcgctgcaaccccatctacgtcagccgggtggtcagcgccatggtcaacagctct
gatgacggcggcgttgtgatgggaaactggggaaatgactacagcggcgggctcccgccc
acccactggagtggcagctacgccatcctgaagcagtggtacaactcctactaccgctcc
gtcagatacgggcagtgctgggtgttcgccggcgtcatgtgctctgtgatgcggctgctg
ggcattccctgccgtgtcgtcaccaacttccagtcggctcatgacaccaacaagaatctg
accatcgacaactactttaattataacggagcgatggagagggaatccacagacagtatc
tggaacttccacgtctgggttgaggggtggatgagacgaccagacctggcaaaagatggg
aaatatgatggctggcaggttgtggatccaacaccacaggaaaagagtgaaggtctgttc
tgctgcggcccggcctcagtgaccgccatccggaacggagaaatcgatcttaaatacgac
atcccgtttgtcttcgccgaggtcaacgctgactccgtttcctggctggtgagaagtgat
ggatccaggacaaaaatcttttctgacacaaagacagttggacagtacatctccaccaag
gcggttggctcgtacaagaggacggacatcacagacacctacaagtacagagaaggaact
gtggaggaaagaaaggtctttgcatacgctctcgacaaaatcgtgaatggatcaacgatg
ttgcgagatgctgctggttctcctgacagggtttcgggtccagcgtcgtcgatgagcacc
gtacctccgcctgatccttcacaaccacagctgctcatccgatttgaagaggtctccaag
ccagagaacggcaaggatgtgaacatgaagatgattctgagcagtgacagcagcaccacc
agaacgttttccgtcaacatcagcgtccaggcaatgaaatacacgggccagccagagggg
aacatccagaccgaggtcacagagcagaagctgctgccgaagaaagatctgattgtccct
attaaggtcccattctcagtctaccataagtacatgatacaacgccggaccatgagcata
tcagcggtcatcactgacctacagaataaagacaacgtgtacttggcaacagacagagtt
gtgctcataaaccccccactctccatcactgtgtccaaggaaagcaaggtgaaccaggaa
ctgactgctgaaatggttttcatgaatcctatcgatgagaccttgatggattgcactatg
agtctgtctggaagtggactcatgatcggggaagaaataaccaatcttccaaatctgcag
ccaaactgcagattccgtgttacagtcgtcctcgttccctacaagagcggagagcgaagt
ctgctggtcaacttcagctgcagttccttcagagacatcaagtccagctgcatcgtcaac
attaaaccttga

DBGET integrated database retrieval system