KEGG   Xiphophorus maculatus (southern platyfish): 102218382Help
Entry
102218382         CDS       T02923                                 

Definition
(RefSeq) coagulation factor XIII A chain
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
Enzymes [BR:xma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102218382
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 102218382
NCBI-ProteinID: XP_005807320
Ensembl: ENSXMAG00000001860
LinkDB All DBs
Position
14
AA seq 742 aa AA seqDB search
MSDQGDAPTPSTAPAPPAGRPPKVGHRGRASGPTDYDNFETADIPELEYFVAPGPRGYPP
LTDFLDIWDVDMMRRRDETNKTDHRTNLYHCDNLIVRRGQEFQIKITFSRAYKPNEDKFA
VEFVIGADPQYSKGTYLPVFPTKTRQSSWGGRVIQTNDNVVTMGITPAANCIVGKYHMYV
AVQTPFGIRRTKRDNSRDLYVLFNPWAADDAVFLDDEAERQECVMNELGVIYHGAYDDVS
ERNWNYGQFNYGVLDACLYIMDRSEMPITNRGDPIKVTRKASAMLNSRDDDGVLVGNWSG
DYTYGVAPTSWTGSTDILLSYSGSKMPVCYAQCWVYAAVFNSFLRCLGIPSRVVTNYYSA
HDNDGNLKLDIILDDNGRIDRSRTKDSIWNYHCWNECYMSRPDLPPGFGGWQVVDATPQE
TSDGMYRCGPASVLAIKHGHICFPFDAPFVFAEVNSDVVFYSRKNDGTMEPVRVNKSHVG
RMVLTKAVGSNGRRDITDQYKFPEGSPEERTVLEKAEEFGCKQEKSSPPEADVNVVLPTL
EISVGNDFEFNVEFVNQSLQKRTVQAYVSGSVVYYTGVSSNEFLFKTPTVTIPAQKSVKE
LMTIESRNYLAHLVEQANLNFIVTGKIKETGRIVTAMKVVTLHTPKLTVEVTGGGRVNEE
MMASVQFTNPFSFNLENVHLRMEGPGVMELKSRYYSLLPGGSSLTWTEMFAPQRAGKTRV
MATLDCSGLRQVSGQASITIET
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccagggcgacgccccgaccccttccactgcccccgctcctcccgccggacgt
cctcccaaggtgggccaccggggccgagcgtcaggccccacggattacgacaactttgag
acagccgacatcccagaattagaatactttgtagcaccgggtccgagaggataccctcct
ctgacagacttcctggacatctgggatgtggacatgatgaggaggcgagacgaaaccaac
aagaccgaccaccgcaccaacctgtaccactgcgacaatctcatcgtccgccgaggtcaa
gagttccagatcaagatcaccttcagtcgtgcttacaaacctaatgaggacaagtttgcc
gtggagtttgtcattggcgccgaccctcagtacagcaaggggacctaccttcctgtgttt
cccaccaagacccgtcagagctcctgggggggtcgcgtcatacagaccaacgacaacgtg
gtcaccatgggcatcacgccagcagccaactgcattgtgggaaaatatcacatgtacgtt
gcagtgcagactccgtttggcattcgtaggacgaagcgggacaacagcagagatttatac
gtcctcttcaatccttgggcagcagatgatgctgtgtttctggatgatgaggcagagagg
caggagtgcgtgatgaacgagttgggggtcatttatcacggcgcttatgacgacgtgtcc
gagagaaactggaactatggacagttcaactatggagttctagatgcctgtctgtacatc
atggatcggtctgaaatgccaatcaccaacagaggagaccccataaaggtgaccagaaag
gcctctgccatgttgaactcacgtgatgatgacggcgtgctggtggggaactggagcggc
gactacacctacggagtggcgcccacttcctggaccggcagcaccgacatcctgctcagc
tactccggcagcaagatgcccgtgtgctacgctcagtgctgggtctacgctgctgtcttc
aattccttcctgcgctgtctgggcatcccgtccagagtggtcaccaactactactctgct
cacgacaacgacggaaacctgaagttggacataattctggacgacaacggcagaatcgat
cgaagccgcaccaaggactccatctggaactatcactgctggaacgagtgctacatgtcc
agaccggacctccctccaggttttggaggctggcaggttgtggacgcaacgccacaggaa
accagcgacgggatgtacagatgtggacctgcgtctgtcctggccataaaacacggacac
atttgcttcccatttgatgctccctttgtgtttgctgaggtcaacagcgacgtcgtgttt
tactcacggaagaatgacgggaccatggagccggtcagagtgaacaaaagtcacgtgggt
cgcatggttttgaccaaagctgtgggaagcaatggtcgtcgagacatcaccgatcaatac
aagtttcctgaaggaagcccagaggagcggactgtcctggaaaaggcagaggagttcggc
tgcaagcaggagaagtccagcccccctgaggcggatgtgaacgtggtcctgcccaccctg
gagatcagtgtcggcaatgactttgagttcaacgtggagtttgtcaaccagagcttgcag
aagcgcacggtgcaggcctacgtcagcgggagtgtggtgtattacaccggagtctccagc
aatgagttcctgttcaagacccccactgtgaccattccggcccaaaagagtgtgaaggag
ttgatgacgattgagtcgaggaactatcttgctcacctggtggaacaggccaaccttaac
ttcatagtcactgggaagatcaaagaaaccggccgtatcgtgaccgccatgaaagtggtc
accctgcacactcccaaactcactgttgaggtgactggcggcggcagagtgaatgaagag
atgatggccagcgtgcagtttaccaaccccttctccttcaaccttgagaacgtccacctc
cgaatggaaggacccggagtcatggagctcaaatccagatactacagtctgctccccggt
ggctcctctctgacctggactgagatgtttgctccacagagggctggcaagaccagagtg
atggctactctggactgttctggcctcagacaggtctccggccaggcatccatcaccatt
gaaacctaa

DBGET integrated database retrieval system