KEGG   Xiphophorus maculatus (southern platyfish): 102218572Help
Entry
102218572         CDS       T02923                                 

Gene name
ezh2
Definition
(RefSeq) histone-lysine N-methyltransferase EZH2
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102218572 (ezh2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xma03036]
    102218572 (ezh2)
Enzymes [BR:xma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102218572 (ezh2)
Chromosome and associated proteins [BR:xma03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102218572 (ezh2)
   Polycomb group proteins
    PRC2-EZH2 complex
     102218572 (ezh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRC2_HTH_1 SET EZH2_WD-Binding preSET_CXC
Motif
Other DBs
NCBI-GeneID: 102218572
NCBI-ProteinID: XP_005812771
Ensembl: ENSXMAG00000012115
UniProt: M4ACI0
LinkDB All DBs
Position
21
AA seq 759 aa AA seqDB search
MVLTGKRSDKGPACWKRRVKSEYMRLRQQKRFRRADEVKSMFNSNRQKIVERTDTLNQEW
KTRRIQPVHIMTSVSSLRASRECTVESGFSEFPRQVIPLKTLNAVASVPVMYSWSPLQQN
FMVEDETVLHNIPYMGDEILDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNSMV
QYSDNEDDEEEEEQDFKVEKMETCDGKDQLEDGSKDRHVGNEGRSNSDANKKFPSDKIFE
AISSMFPDKGSTEELKEKYKELTEQQLPGALPPECTPNIDGPNARSVQREQSLHSFHTLF
CRRCFKYDCFLHPFHATPNTYKRKNLENLVNTKPCGAECYMYLVQDGMAREYPAGGERAK
TPSKRSVGRRRGRLPNSSSRPGTPTVSSETKDTDSEREGSKDDERDNDKDDEDKKDETTS
SSEGNSRCQTPVKMKLTCDPEAVDWTGAEASLFRVLIGTYYDNFCAIARLIGTKTCRQVY
EFRVKESAIIARAPAEDEDTPPRKKKRKHRLWATHCRKIQLKKDGSSNHVYNYQPCDHPR
QPCDSSCPCVTAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLT
CGAADHWDSKNVSCKNCSIQRGAKKHLLLAPSDVAGWGIFIKEPVQKNEFISEYCGEIIS
QDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHR
IGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIA
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgacagggaagcgttcggacaaaggtccagcctgctggaagaggagggtgaag
tctgagtacatgaggctccggcagcagaaacgcttcagacgagccgacgaggtcaagagc
atgttcaactccaaccgtcagaagatcgtggagcggacggacactctgaaccaggagtgg
aagacgcggcggatccagccggtccacatcatgacgtcggtcagctcgctgcgcgcctcc
agagagtgcaccgtggagagcggcttctccgagttcccgcggcaggtcatccccctgaag
acactgaacgccgtggcctcggttccggtcatgtactcctggtcgccgctgcagcagaac
ttcatggtggaggacgagacggtgctgcacaacatcccctacatgggagacgagatcctg
gaccaggacggcaccttcatagaggagctcatcaagaactacgacggcaaagtccatgga
gaccgagaatgcggcttcatcaacgacgagatcttcgtggagttggtcaactccatggtt
cagtacagcgacaacgaggatgacgaggaggaggaagagcaggacttcaaggtggagaag
atggagacgtgtgacggcaaggatcagctggaggacggcagcaaggacagacatgtcggc
aacgaaggtcggagcaacagcgacgccaacaagaagttcccgtctgataagatctttgaa
gccatctcctccatgttccctgacaaaggatccactgaggagctgaaggagaagtacaag
gagctgacggagcagcagcttcccggcgctctccctcctgaatgcacgccgaacatcgac
ggcccaaacgctcgctccgtccagcgggagcagagcctgcactccttccacacgctgttc
tgccgccgctgcttcaaatacgactgcttcctccaccctttccacgccacgccaaacacc
tacaagcgtaagaacctggagaacctggtgaacacgaagccgtgcggcgccgaatgctac
atgtacctggtgcaggacgggatggcgagggagtatccggccggcggcgagcgcgccaag
acgccgtctaaacgcagcgtgggccggcgccgcgggcgactgcccaacagcagcagccga
cccggcacgcccaccgtttcctcggaaaccaaagacacggacagcgagcgcgaggggagc
aaggacgacgagcgagacaacgacaaggacgatgaggacaagaaggacgagacgaccagc
agctcagaggggaactctcgctgccagacgccggtgaagatgaagctgacctgcgacccg
gaagctgtggactggaccggcgccgaggcgtctctgttccgggttctgatcgggacgtac
tacgacaacttctgcgccatcgcccgcctcatcggcaccaagacctgcagacaggtttac
gagttccgggtcaaagagtcggccatcatcgcccgggcgccggccgaggacgaggacacg
ccccccaggaagaagaagaggaagcaccggctgtgggccacgcactgcaggaagatccag
ctgaagaaagacgggtcgtccaatcacgtgtacaactaccagccgtgtgaccatccgcgg
cagccctgcgactcgtcctgcccctgcgtcaccgcgcagaacttctgcgagaagttctgc
cagtgcagctccgagtgtcagaaccgcttcccgggttgccggtgcaaagcccagtgcaac
accaagcagtgcccctgttacctggcggtgcgggaatgcgacccggacctgtgcctgacc
tgcggcgccgccgaccactgggacagcaagaacgtgtcctgcaagaactgctccatccag
cgcggcgccaagaagcacctgctgctggcgccgtccgacgtggccgggtggggaatcttc
atcaaggagccggtccagaagaacgagttcatctccgagtactgtggagagatcatctct
caggacgaagccgaccgccgagggaaggtttacgataaatacatgtgcagcttcctcttc
aacctcaacaacgacttcgttgtcgacgccacgaggaaaggcaacaagatccgcttcgcc
aatcactctgtaaacccaaactgctatgcaaaagtgatgatggtcaacggggatcacagg
atcgggatcttcgccaagagagccatccagaccggagaggagctgttcttcgactacagg
tacagccaggccgacgccctgaagtacgtcggcatcgagcgcgagatggagatcgcctga

DBGET integrated database retrieval system