KEGG   Xiphophorus maculatus (southern platyfish): 102219636
Entry
102219636         CDS       T02923                                 

Definition
(RefSeq) transcription factor p65-like isoform X1
  KO
K04735  transcription factor p65
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04010  MAPK signaling pathway
xma04137  Mitophagy - animal
xma04210  Apoptosis
xma04218  Cellular senescence
xma04620  Toll-like receptor signaling pathway
xma04621  NOD-like receptor signaling pathway
xma04622  RIG-I-like receptor signaling pathway
xma04623  Cytosolic DNA-sensing pathway
xma04625  C-type lectin receptor signaling pathway
xma04920  Adipocytokine signaling pathway
xma05132  Salmonella infection
xma05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xma00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102219636
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102219636
  09143 Cell growth and death
   04210 Apoptosis
    102219636
   04218 Cellular senescence
    102219636
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102219636
   04621 NOD-like receptor signaling pathway
    102219636
   04622 RIG-I-like receptor signaling pathway
    102219636
   04623 Cytosolic DNA-sensing pathway
    102219636
   04625 C-type lectin receptor signaling pathway
    102219636
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102219636
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102219636
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102219636
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xma03000]
    102219636
Transcription factors [BR:xma03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    102219636
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 102219636
NCBI-ProteinID: XP_014324622
Ensembl: ENSXMAG00000011436
UniProt: M4AAG6
LinkDB
Position
14
AA seq 629 aa
MDGVYGWGMTPINPVQPATPYIEIIEQPKQRGMRFRYKCEGRSAGSIPGEKSNDTTKTYP
AIKVHNYSGPLRVRISLVTKNPPHKPHPHELVGKDCKHGYYEADLQERRIHSFQNLGIQC
VKKKDVNEAITCRLQTSNNPFSIPEPKVWEEEFDLNSVRLCFQASITLPTGDMFPLPPVV
SQPIFDNRAPNTAELKICRVNRNSGSCRGGDEIFLLCDKVQKEDIEVRFYQDSWEGKGTF
SQADVHRQVAIVFRTPPYRDTNLSEPIKVKMQLRRPSDREVSEPMDFQFLPADPDEYRLS
EKRKRTGDMFQNLKLGSMLSTVSVPQDRRHINLARRPVAAKLSSMNTQAAAEVAPSASGL
KPFSYNQPGQLFSVQPKVEASSSISTATTNQTWKIMESLKLGPTNPVQTFTMSSVSAPSS
STASTAANNEYSTVNLSDLHEFFPNISSPMAEESAAPQGSAAAPQTGSTFPLQESQFRVD
PPLVDDEIPDFSNFTDAPVPGTLDSLNMDEFEDLLNPRLMSEGGSAASMLTSSQHGVLSS
SAAASHNGSSSQNLPDHVNNPGSTYMNYPNSIANLLRNEDMIILASSSNINQQPAVLDDF
DVLMSADEDRLISIFNSGSQAGFVSGHPT
NT seq 1890 nt   +upstreamnt  +downstreamnt
atggacggtgtgtacggctggggcatgacccctattaacccagtccaaccagcgacccct
tacatagagatcatcgagcagccgaagcagagggggatgaggttccgctataaatgtgag
ggtcgctcagctggcagcattcctggagagaaaagcaacgacaccactaagacctacccg
gccatcaaggttcacaactacagcggcccgctccgggtccgcatctccttggtgacaaag
aaccctccgcacaagccccacccccacgaactggttgggaaagactgcaaacatggctac
tatgaggccgacctgcaggagagacgaatccacagttttcagaacctgggcattcagtgt
gtgaagaagaaggatgtcaacgaggccatcacttgcagactgcagaccagcaacaacccc
ttcagcattcctgagcccaaggtgtgggaggaagagtttgacctgaattctgtgcgactt
tgcttccaggcgtccatcacccttcccacaggggacatgtttcctctgccgcccgtcgtc
tcgcagcccatctttgacaacagagccccgaacacagccgagttgaaaatctgcagagtg
aaccgtaactccggcagctgcagaggaggggatgaaatcttcctcctctgcgataaagtg
caaaaagaggacatcgaggtgcggttctaccaggactcctgggaggggaagggcacgttc
tctcaggctgacgtccaccggcaggtggccattgtgttccgcacgcctccctatcgcgac
actaacctcagcgagcccattaaggtgaagatgcagctcagacggccctctgaccgtgaa
gtcagcgagccgatggacttccagttcctacctgctgacccagatgaatacaggctgtct
gagaagagaaagcgtacaggagacatgttccagaacttgaagctgggatctatgttatca
actgtgtccgttccacaagacagacggcacataaacctcgcacggagaccagttgcagct
aaactgagttcaatgaacacacaagcagcagcggaggttgcgccttctgccagtgggttg
aaacccttctcatacaatcaaccaggacaactgttctcagtccagcctaaggttgaggca
tcttcgtccatctctacggcgactaccaaccaaacctggaagatcatggagagcttgaag
ctgggccccaccaacccggtgcagaccttcacgatgagctccgtgtcggccccttcctcc
tccaccgcctccaccgctgccaacaacgagtactccaccgtcaacctgtccgaccttcac
gagttcttccccaacatttcctcccccatggccgaggagtccgcggctcctcagggaagc
gccgccgccccacagactggcagcaccttccccctgcaggagtcccagttccgggtagac
cccccgctggtggacgacgagatcccggacttctccaacttcaccgacgctccggtgcca
ggcaccctggacagcctcaacatggatgaattcgaggaccttctgaacccgcgcctaatg
agcgagggtggatctgccgcgtccatgctgacatcttcccaacatggagtcctctccagc
tcggctgctgcgtcccacaacggctcctcatcccagaacctcccagaccacgtcaacaac
ccaggaagcacctacatgaattaccccaacagcatcgccaacctgctccggaacgaggac
atgatcatcctggcgtccagcagcaacatcaaccagcagcccgccgtgctggatgacttc
gacgtgctgatgtccgccgacgaagaccgcctcatctccatttttaacagcgggagccaa
gctggctttgtgtcaggacacccaacttaa

DBGET integrated database retrieval system