KEGG   Xiphophorus maculatus (southern platyfish): 102219717Help
Entry
102219717         CDS       T02923                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASH1L-like isoform X1
  KO
K06101  histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    102219717
Enzymes [BR:xma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102219717
Chromosome and associated proteins [BR:xma03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102219717
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET BAH Bromodomain PHD
Motif
Other DBs
NCBI-GeneID: 102219717
NCBI-ProteinID: XP_023201010
Ensembl: ENSXMAG00000014673
LinkDB All DBs
Position
13
AA seq 2933 aa AA seqDB search
MDQKVQGQTATPPPLLSAAVSAEREKEGGGGKKEEENEKKQEREKEGTAAGPPGTGGPGN
PGGDQSLFSITESSLSEGNVKLKIGLQAKRMKKPPKSLENYVCRPAFRATVRHTSRGGSS
VRGNRAVAAGDGASGQSQSPSKSQGKEREKSPGLKKTPATSSSLAPSGKAITPSSPAAPP
GITKTPSPSQVNGGSAPAKKGPSKVDCKADSKSDTKSVTTTSERPLNLHRPPPDNKTHSS
GKKTPTPQPNSRTSSPSSPPTASKEPTFEGIKPPHYTYSMEGQRDKDKGVQSCGPPTVTE
KLAQLIATCPPSKTPKPTKPTKTDPNPPLPSSGFMAPTAKQRDRAMANRNTYSRLMHLSP
PPPVSRPPGRPYGSRNRDGVPENSPTLMHLRKEDSDGAGKAIATNINNSIAIGNSRSRSS
SPAFTHSRPTVLSKDTNYDGSNSSNGLSKSLSRGTHSLPSSPSCLVSSSSSSISAEQRTV
TVVSHLSSPAPSQGHHTQEALALAEESRAGEREQGSDSPRDLNKCPPTARIGKPEGKDKV
GSNQSLHVERGRSSSPKKRSPNRDSSQPRRTASPPEPNRQRMPSASEPDDEESPPTPHRD
DSPDSSLDSPDEQDSKPLKKRRGRKPRWVMNKPQTLLASQDGLFNENKTSMSLSSSLETL
SPPVKRPVGRPPNPNKVKPSLVPHSSMSQLFPPQPKKRGRPKFKMPRLDAPAPGNPSYKL
ASSKVFSSLLKSKEEQDPPVLHPEVDLNPPKPIPRKRGRPKRLPPTLPQEGQPPTLAPEA
GDMGDKRFCSKGNGQLIMKTIIGKINKMKSVKRKRILNQILLGPRTEETPKNSTVGMVNS
TEATTQSLSSLAASFGGKLGPQINVSKKGTIYMGKRRGRKPKSVSTLTASSPEPFLSPNT
TSPLHHHSQSQQHQLSSEVFPSPSLSQSSGSHSPISDASFVEPSSVHFSHYSSSHHNHSS
FSFPPPIFSVPSKVLGSTSSTVASQKKSSCRGYPHHHHYRQQFHYHKLSPPRPLHPTSPA
PLSELKEATPSPVSESHSEETVPSDSGIGTDNNSTSDRGEKAGGTAGLGGIALPAAMGGG
LLMPGVMSSAMAPGMGLNSRGRRRHSAVLIEHPSPSPSPHGTRSSPDPRRPHPAAPTSTL
LGHKEKHKHKCKRRNHGCPGYDKMKRQKRKRKKKYLQLRSRRLDPDFLAELDEIVVMLSE
IRISHRSTGHRLGSGISMVAGTSRMPGLGSRAAGGIGGPSGPPPHHYVHRDLLPTIFRVN
FGRFYSHPAYSCDPLHYVRKPDMKKKRGRPPKLRESMSEVPFVPGLGFPLSSGGFYHPSY
GVPYSSGPLGLGYYRGFPPANALYPHPHHQSPHTAPSHHSHHSPSFPPPPPTSYMHHHHP
SHLLLNPSKFHKKKHKLLRQEYLGGGRPPVLFPPMSSELSFNWHHKHKHRHKHRERCSEE
DREEVLRSGGSASRVSAGLSDKGATSKGERVGGLGMTESLQRCRFGRDTSGTTTSKQASA
NSPSSSSSSSAERYKRKESSMSCLGPSRLTLDNSSKGHHGVASWFRMGSPEADYAKLSRS
QMAVGQGSFSDGRAGEPAGCSDSEDEEPLTPTEDVEAHDSPNLTNLFASALTRTSLKGGR
SRKSEIVTESSSFSHLDRPMRKDRSTSAERRDLGASVQSRGVALTASDGPEGSLHSRQQL
HHQSSLFHSHVSPGSSCLSPSQDFCLDASLSHRSHRVQTSKHSLHHVNKILRAKKLQRQA
RTGNNVVKKRGPGRPRKYPLPSPPPSPPPEVELTQTVHRDGGVERLAGQRGWEEDTVTDA
IESVVQGQHRKGQKRAHVEAEGDEEEEEQAEEDPEAEEVEEQPPDREESQTNLPQRSRTG
TGRSWPAEEEHQYIQGSTESKPDGQCSTELSGAVSKEQAAPISSQREKKAARLPKKKFQK
AGLYSDVYKTEDPRSQLLQLKKEKLEYIPGEHEYGLFPAPIHVGKYLRQKRIDFQLPYDI
LWLWKHDQLYKRPDVPLYKKIRSNVYVDVKPLYGYEMTTCNCRAPEMSTEKGCLDDCLNR
MSFAECSPSACPCGDQCDNQHIQRHEWVQCLERFRAEGKGWGIRTKESLRAGQFIIEYLG
EVVSEQEFRNRMMEQYHNGHYCLNLDSGMVIDSFHMGNEARFINHSCEPNCEMQKWSVNG
VYRIGLFALKDIHSGTELTYDYNFHSFNTEEQQVCKCGSESCRGIIGGKSQRINGLPGKT
GGARRLGRLKEKRKSKHQLKKREEESSDSNKFYPHLMKPMSNRERNFVLKHSVFLLRNWE
KMREKQELQKREGERERDPSSISMYARWGGVIRDDGNIKSDVFLTQFSALQTSRSVRTRR
LAAAEENTEVTRTARLAHIFKEICDMITSYKDSSGQILAAPLVNLPSRKRNSQYYEKVSD
PLDLSTIEKQILTGHYKTVEAFDTDMLKVFRNAEKYYGRKSSVGRDVCRLRKAYYSARNE
AAVQIDEIVGETASEADSSDSLERDHVHHHGGGSGSHDKDDDVIRCICGMYKDEGVMIQC
EKCMAWQHCDCMRLETEVEHYLCEQCDPRPVDREVPMIPQPSYAQAGSIYYICLLRDDLL
LHQGDCVYLMRDSRRSPEGQPVRQSYRLLSHINREKLDIFRIEKLWKNEKGERFAFGHHY
FRPHETHHSPSRRFYQNELFRMPLYEIIPLEAVVATCCVLDLYTYCKGRPKGVKEQDVYI
CDYRLDKSAHLFYKIHRNRYPVCTKPYAFNHFPKRLAPKRDFSPHYVPDNYKRNGGRSAW
KSERTKEAAGCEDDGSSCDRGDDFPHRAEDGRSVEDDVDMVPEEPEHIPAKPRQKERARP
GGEEEDEEEEEGLEAGVRKEIGESSEDRIGEMLELPLSSASSPLHHPALSRREAQRERLN
KILLDLLHRAPSKNGEGPGAKQGAIDVTYLLEEGAGRRLRRRTLGFADFVIRK
NT seq 8802 nt NT seq  +upstreamnt  +downstreamnt
atggatcagaaagttcaggggcaaactgcaacaccacccccacttctctctgctgctgtc
tcagcggagcgagagaaggagggaggaggtgggaaaaaggaagaagagaatgaaaagaag
caagagagggagaaagagggaactgccgccggtcctcctggcacaggtggaccaggaaac
cccggaggggaccagtccctattctccatcacggagagcagcttgtccgagggaaatgtc
aagcttaagattgggctgcaggcaaaacgcatgaagaagcccccgaagagcttggagaac
tacgtgtgccgacccgccttccgggccaccgtgaggcacacgagtcgtggaggaagcagc
gtccgtggaaaccgggcggtggctgccggcgatggcgctagtggtcagagccaaagccct
tcgaagagccaagggaaggagagggaaaagagtccaggtttgaaaaaaacaccagctaca
tcatcttcactagccccctctggtaaagctattactccgtcttctccggctgctcctcct
ggtatcacaaagactccatcgccctcccaagtaaatggcgggagtgcaccagctaaaaag
ggtccatcaaaggtagactgcaaggccgattcaaagtcggatacaaagtcagttactacc
acatcagaaagacccctcaaccttcaccgaccgccgccagacaataaaactcattcctct
gggaagaaaacaccgactccacaacccaactcaaggacatcttcaccttcttcgccacca
actgcatcaaaagagccgacctttgaaggcatcaaacctcctcattacacttacagcatg
gaaggtcagagagacaaggacaagggtgtccagagttgtggaccacccactgtcactgag
aaattagcccagcttatagcaacctgcccaccgtcaaagactcctaagccaactaaaccc
acaaaaacagatccaaatcctcctcttccaagttcaggcttcatggctccaacagccaag
cagcgagacagggcaatggctaataggaacacatattcaagactaatgcacctttcgcct
ccaccgccggtgtccagacctcctggtcggccttatggctccaggaacagagatggcgtc
ccagaaaattcacccacccttatgcacttgaggaaggaagactcagatggggctgggaaa
gctattgctaccaacatcaacaacagtattgctataggcaacagcagaagtcgcagtagc
agccctgcattcactcacagccgccccacagtcttatctaaggatactaactacgacggc
agcaacagctctaatggtctatccaagtcactgtcacgtggcactcacagcttgccatct
tctccatcttgcctagtttcttcatcttcctcctccatctcagctgaacagaggacagtg
actgtagtaagtcacctgagctcccctgctccctcacaaggacaccacactcaggaggcc
ctggccctggcagaggaaagtagggcaggtgagagggagcagggcagcgacagccccaga
gacctaaacaagtgccctcctacagcaagaataggaaaaccagagggaaaagataaagtg
ggaagtaatcaatcactgcatgtggagagggggagaagctccagtcccaaaaaacgcagt
cctaacagggatagtagccaaccgagacgaaccgccagtcctcctgaacccaatagacaa
aggatgccttcagcatctgagccagatgacgaagaaagcccaccaacgccccatagagat
gattcacccgattcatccctggactcgccagatgagcaggatagtaaacccctaaaaaaa
cgcaggggaagaaaacctcgctgggttatgaacaagccacagactcttctagcaagtcag
gatggtctcttcaatgagaacaaaaccagcatgtctttgtcttcaagtttagaaacgcta
tctccaccagtaaaaagaccagtaggaagaccaccaaacccgaataaggtcaaaccaagc
ctcgtgccacacagttcaatgtcgcagctgtttccaccccaacctaagaaaaggggacgg
ccaaagttcaaaatgccaagactcgatgccccagctcctgggaacccctcttataagctg
gcctcttccaaggtcttttcatctcttctgaagtccaaagaagagcaggacccgcctgtt
cttcacccggaggtagacctaaaccctcccaagcctatacctagaaaacgtggacgtccc
aaacgcctccctccgaccttaccccaagagggtcagcctcccacattggctcctgaggca
ggagacatgggagacaagcggttctgtagcaaaggaaacgggcagctcattatgaaaaca
attatcggcaaaatcaataagatgaaaagcgtgaagcggaagcgtattctgaatcagatc
ctgttgggtccaagaacagaggaaactcctaaaaacagcactgtcggaatggttaactct
acagaagctactacccagtccttgtcctccctggctgcttcttttgggggaaaattagga
ccgcaaattaacgttagtaaaaagggaacaatatacatgggtaagagaagagggcgtaaa
ccaaaatctgtatccactctcactgcctcgtcaccagaacccttcctgtctccgaacacc
acttctcctcttcatcaccactctcagtcccagcagcaccaactgtcctctgaggtgttt
ccctcgccctccctgtcgcagtctagtggcagccacagccccatcagtgatgccagcttt
gtggaacccagctcggtgcacttttcccactattctagctcccatcataaccacagctca
ttttccttccctcccccaattttttcagtccccagtaaagtcttgggctccacgtcgtcc
acagtagcttcccagaaaaagtcttcttgccgtgggtaccctcatcatcatcattacagg
cagcagtttcattatcataagctttctcctcccaggccgctccacccaacctcccctgct
cctctcagcgagctaaaggaagccactccttcaccagtcagtgagtcgcacagtgaggag
acggtgcccagcgacagcggcataggaacagacaacaacagcacatctgaccgaggagag
aaagccggagggacagcaggcttgggcggaatcgctttgccagcagcaatgggtggtggg
ttgttgatgcccggtgtaatgagctcagcaatggccccgggaatgggcctaaactccaga
ggcaggcgccgccactccgccgtgctcatagagcacccctcaccatctccttcgccccat
ggaacgaggtcttcacctgatcccaggaggccgcatccggcggctcccacctcaacgttg
ttgggacacaaggaaaaacacaagcacaagtgcaaacgccgcaaccacggatgcccgggc
tatgacaagatgaagagacagaagaggaaacgaaagaagaagtacttgcagctgcggtcc
cggcgacttgaccccgactttctggccgagttggacgagatcgtcgtgatgctgagtgag
atacggatatcacaccgttccacagggcaccgccttggcagtgggatcagcatggtggca
ggaactagtcggatgccagggctggggagtagagctgctggcggaatcgggggacctagc
ggcccccctcctcatcattacgttcacagggacctcctccccacaatcttcagggttaac
tttggcaggttttactctcaccctgcatactcctgtgaccctttgcactatgtccgtaaa
ccagacatgaagaagaaacgcggacggcctccaaagttaagagaatccatgtctgaggtc
ccttttgtccccggccttggattccctctctctagtggaggtttctaccacccctcctac
ggtgtcccctactcctcagggcccctggggttgggctattacagaggctttcctcctgca
aacgccctatatcctcacccccaccaccagtcgcctcacactgctccttctcaccactcc
caccactcaccatcttttcctccccctccacccacatcctacatgcaccatcaccacccc
tcgcatctcctcctaaacccctcaaagttccacaagaagaagcataagctgctcaggcag
gagtacctgggcggagggaggccccccgtcctgttcccacccatgtcctccgagctgtcc
ttcaactggcatcacaaacacaaacacaggcacaaacacagagagcggtgctctgaggaa
gaccgggaggaagtgctaaggagcggcggatccgcgagccgggtcagcgcaggtctttct
gacaaaggagccactagcaaaggagagcgagtcggaggtctaggaatgaccgagtcgtta
caaagatgcaggtttggaagagatacctcaggcaccactacgagtaaacaagcttctgcc
aactccccctcctcctcctcatcttcatctgcagaaagatataaacgcaaagagagctcc
atgtcctgtctaggaccgtctagattaaccctggacaacagctcaaagggccatcatggc
gttgcatcctggtttcggatgggcagcccggaagcagactacgctaagctttcacggagt
cagatggccgtcggccagggctcgttctcagatggacgtgcaggagagcctgcaggctgc
tcagacagcgaggatgaagagcctctcactcccacagaggatgtagaagctcatgattct
cctaatctgacaaatctgtttgcctcagctctgacacggacttcgctgaagggaggaagg
agcagaaagagtgagatagttacagaaagctccagcttttctcacctggatcgtccaatg
agaaaggaccgttcaacatcagctgaaaggagagatttaggggcatcagttcagtccaga
ggtgttgctttgacggcttccgacggacctgagggatctctgcacagccggcagcagctc
caccaccagtcctctctgtttcactcccacgtctctccgggttcttcctgcctgtctccc
tcccaggacttctgcctggacgcctccctttcccaccgctcccatcgggttcagacgtcc
aagcacagcctgcatcatgtcaacaaaatcctgcgtgccaaaaagctgcagagacaggct
cgaacaggtaacaacgtggtgaagaagaggggcccgggccgccctaggaaatacccgctg
ccctcccctcctccttctccgccccctgaggtggagttaactcagacagtgcacagggac
ggtggggtggagcggctagccggtcagagaggatgggaggaggatactgttacagatgct
attgagtccgtggtccagggacagcatagaaaaggtcagaagagggcacatgtggaggcc
gagggggatgaagaagaggaagagcaagctgaagaagacccggaggcagaggaagtcgag
gagcaaccgcctgacagagaggagagccagacgaacctgccgcaaagatccagaaccggg
acaggaagaagctggcctgcagaggaggaacatcagtacattcagggttccacagaaagc
aagccagatggtcagtgctctacagaactctcaggcgccgtctccaaggagcaggctgca
cccatcagcagccagcgagagaagaaagcggcccgacttccaaagaagaagttccagaaa
gcaggactgtattctgatgtgtacaagactgaggaccctcgcagtcagcttttgcagcta
aaaaaggagaagctggaatacatacctggagagcatgaatatggattgtttcctgctcca
atacatgttgggaagtacctgagacaaaagaggattgatttccagttgccttacgacatc
ttatggttgtggaaacatgatcagctttacaagagacccgatgtccctctttacaaaaag
atcagatcaaatgtgtatgtagatgtgaaacctctctatgggtacgaaatgactacttgc
aactgcagagctccagagatgtcaacggaaaaaggatgcctggatgattgcttgaatagg
atgagctttgcagagtgctcccccagtgcctgtccttgcggcgatcagtgtgacaaccag
cacatccagagacacgagtgggtccagtgtctggagcgtttccgtgccgagggaaaaggc
tggggaatccgcactaaagagtctctccgagccggtcagttcatcatcgaatacctgggg
gaagtggtcagtgagcaggagttcaggaaccgaatgatggagcaataccacaacggccac
tactgtttgaaccttgacagcgggatggtgattgacagtttccatatgggcaacgaggca
cgcttcataaaccacagctgtgaacccaactgtgagatgcagaagtggtcggtgaacggg
gtttacagaatcggtctctttgctctgaaggacatccacagcggcactgaactcacctac
gactacaacttccattccttcaacaccgaggaacagcaagtctgcaagtgcggctcggag
agctgccggggcatcatcggagggaagagccagcgcatcaacggcctcccgggaaaaaca
ggaggcgctaggagactgggccgactcaaggagaagaggaagtcaaaacaccaactcaaa
aagagagaggaagagtccagtgacagcaacaagttttatccacatctcatgaagcccatg
tctaacagagagagaaactttgtgctgaagcacagcgtgtttctcctgcgaaactgggag
aagatgagagagaaacaagagcttcagaagagagagggagaaagagagcgggatcccagc
agcatctcgatgtacgctcgctggggaggtgttatccgagacgatggcaacatcaagtca
gatgtgttcctgacccagttctcagctctgcagacgtcgcggtcggttcggactcggaga
ctcgctgccgctgaagaaaacacagaagtgacgcgcaccgcgcgtctggcgcacatcttc
aaagagatctgtgacatgatcaccagctacaaagactcatcgggacaaatccttgctgct
ccgctggtgaacctgccatccaggaagaggaacagccagtactatgagaaggtgtccgac
cctctggacctgagcaccatcgagaagcaaatcctcaccggccattataagacggtggaa
gcgttcgacacagacatgctcaaagtgtttcgcaacgctgagaaatattacggcaggaag
tcctcggtgggccgggacgtgtgccggctgaggaaagcttactacagcgcccggaacgaa
gccgccgtccagatcgacgagatcgtgggcgagaccgccagcgaggccgacagctcggac
tcgctggagcgcgaccacgttcaccaccacggaggggggtcggggtcgcatgacaaggac
gacgacgtcatccgttgcatctgcgggatgtacaaagatgaaggagtgatgatccaatgt
gaaaagtgcatggcgtggcagcattgtgactgcatgcgtctggagaccgaagtggagcac
tacctgtgtgagcagtgtgaccctcgacctgtagacagggaagttcccatgatcccccag
cccagctatgctcaggctggctccatctactacatatgtctccttagagatgacctgctg
ttacaccaaggtgactgtgtgtacctgatgagagacagccggcgcagtcctgaaggccaa
cccgtccggcagtcttaccgtcttctgtcccacatcaaccgagagaaactagacatcttc
cggatcgagaaactgtggaagaacgaaaagggcgagcgctttgcttttggtcatcactac
ttccgtccacatgagacgcaccattccccgtcgcggcgtttctaccagaacgaattgttc
cgcatgccgctgtacgagatcatccccctggaggcggtggtggcgacatgctgtgtcctc
gatctttacacctactgcaaaggcaggccaaaaggcgtgaaggagcaagatgtgtacatc
tgcgattatcgcctggacaaatcagcccacctgttctacaagatccatcggaaccgctac
cccgtctgcaccaagccgtacgccttcaaccacttccccaagcggctcgcgcccaaaaga
gacttctcgcctcattatgttcctgacaactataagaggaacggaggccggtctgcctgg
aaaagcgaacgaaccaaagaagcggctggctgcgaggacgacggctcctcctgcgaccgc
ggcgacgacttcccccacagggcggaggatggacggtcagtagaggacgacgtggacatg
gtgccggaggaacctgaacacattccagccaaaccaagacaaaaggaaagggcgagacca
ggaggtgaggaggaagacgaggaggaggaggaagggctggaggccggggtgcggaaagag
atcggggagagttctgaagaccggataggggagatgctcgaactccctttgtcttcggcc
tcctcgcctctccaccacccggcgctgagccggagggaggctcaaagggaacggctcaac
aagattctactggacctgctgcacagagcgcccagcaagaacggtgagggaccgggagca
aagcagggggctattgatgtcacctatctcctcgaggaaggagcaggacggcggttacgg
cgaaggacgctcggatttgcagattttgtcatcagaaagtaa

DBGET integrated database retrieval system